KEGG   Amphimedon queenslandica (sponge): 100633443Help
Entry
100633443         CDS       T02284                                 

Definition
serine/threonine-protein kinase mTOR-like
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100633443
Protein kinases [BR:aqu01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [Table]
   100633443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1456 aa AA seqDB search
TFWAPDSPIQITIVLLVEKIILAMGDELKIYLPPMVQPVLRLFMQDQSEQKLVTQKMLCA
LQYCGSSLDDYLHLLVPAIVKVFQNPTNPIEARTIALETIEKLSSSLDFSDYCSQIIHAV
VDVLDTVPDLRGVAMDVLCSMMIQLGPRYKIFIQMVKKVLTKYRYSHAAYELLLCRLLKD
EPLTPDDDVERHIKSRKQQSTDDEAAEIEAVSFKKFSLDVNSLTKAWSTAGRISKDDWIE
WLRRLGVELLKESPSPSLRSCWALAQAYNPLARELFNAAFVSCWMELKSVHQEDLVVNLK
QFLTRDSIPEITQTVLNLAEFMEHCEEGRFPLSSELLGECAMNCRAYAKALHYKEEDFHR
GVTPKLLESLIAINNKLQQPDAAVGVLMFAKERQQGDFKIQEEWYESLNDWEAALHLYQT
KQYSRPDDIKIALGRMRCLHAMGEWNRLYDIASEMWPLGDDDTRQQMSVMATAAAWGLNQ
WESMEEYVRCIPKESFDGAFYQSLLNIHNHCFIDAQKSIDKARSSLDAELTALVGESYNR
AYHLMVSVQLLSELEEIIQCLVRPEKKKQLQKTWWNRLLGCQRNMEDWQRILQVRSLVLT
QQEELKSWIKFASICRKSGKLVLSERTLITLLSNDQSFNIDADPLSVKFPQVTLAYMKHK
WHADQKQEAFRLLDQFVVRLQSDNIDPSASNETNQLLARCYLKLGDWKAELNPDSSSLTT
SFSSILHYYELATKFDRQWYKAWHAWAFMNFQALLHQRQEQQKLQKTNVILSEDSTSSES
TNKIGPVDMTASIQYSSSAVHGFFRSISLSSGNSLQDTLRLLTLWFDYGHISEVHEALEE
GIKTVDIENWLQVIPQLIARIDSPRRLVSKLIHELLTDVGRHHPQALIYPLTVAAKSQST
VRRDAADMILSNMREHSSDLVQQAVMVSEELIRVAILWHEQWHETLEDASRMYFGEHNVQ
GMFKVLDPLHQKLDKGPETLKEISFNHAYGRDLAEASEWCKKFQTSSNVKDLTQAWELYY
HVFRRISKQLPQLTTLELQYVSPKLLACKDLELAIPGSYEPHCPIIHIKSVSSSLNVITS
KQRPRKLVMEGSDGRSYMFLLKGHEDLRQDERVMQLFGLVNTLLDNDPETFKRHLRIQRY
SVIPLSPNSGLIGWVPHCDTIHALIRDYRDKKKIMLNIEHRLMLQTSSDYDHLMLMQKVE
VFEQAINSTTGDDLAKVLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYVLGLGDRHPSNLM
LDRLTGRILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGIEGNFRRTCCSVMR
VLRDNKDSVMAVLEAFVYDPLLNWRLMDDNGKAKSKPIPQQSDTTTITTSNATTNNSTGR
LFPTPGVDVPESQQYHPEELNRKALAIIERVRQKLTGNDFRHEKMINVDRQVQLLIEQAT
SHENLCQCYIGWCPFW
NT seq 4371 nt NT seq  +upstreamnt  +downstreamnt
acattctgggcccctgacagtccaatacagatcacaatagtgctcttagttgagaagatc
atactagcaatgggagacgagttgaagatatacctccccccaatggtacagccagtactt
cgtctctttatgcaagatcagagcgaacagaagcttgttactcaaaagatgctttgtgct
cttcaatattgtggctctagtttagatgattaccttcatttgctagttccagcaattgtt
aaagtttttcagaatccaactaacccaatagaagcaagaactatagcactggagactatt
gagaaactgagtagttcccttgacttctctgattattgttctcagatcattcatgctgtc
gttgatgttttagatactgtccctgatctacgtggtgtggctatggacgtcctttgttca
atgatgattcagttaggaccacgctacaagatattcattcaaatggtgaaaaaggtatta
acaaagtatcgttactctcatgctgcctatgagctcctgttgtgtagactattaaaagat
gagccactcactcctgatgatgatgtagagcgacacatcaaatcaaggaagcagcaaagc
actgatgatgaagcagcagagattgaggcagtgtcttttaagaagttttcacttgacgtg
aactccttaacaaaagcctggagcactgctggtaggatatcaaaggatgattggattgaa
tggctgagaagattaggagttgaactattaaaggagagcccctctccttcattaagatcc
tgctgggcactggctcaagcttacaatccactggccagggaattattcaatgccgccttt
gtatcatgctggatggaattaaagtctgtccatcaagaggatctggtggttaatttgaag
cagttcctcactagggacagtatccctgagataactcaaactgtccttaacttagccgag
ttcatggagcactgtgaggagggacggtttcctctaagctcagaactattaggagagtgt
gctatgaattgtagagcctatgctaaggctcttcactacaaggaagaggactttcatcgt
ggagtgacaccaaagctactagagtcactgattgctattaataataagctccaacagcct
gatgctgctgtgggtgtactgatgtttgctaaggaaagacagcaaggagactttaaaatc
caagaggagtggtatgagagtctcaatgattgggaagcagctcttcacttgtatcagacc
aagcagtacagtagacctgatgatatcaagatagccctgggccgaatgaggtgccttcat
gctatgggagaatggaatcgtttgtacgacatagcaagtgagatgtggccattaggagat
gatgacactcgccagcagatgtcagtaatggcgactgcagcagcctggggcctcaaccag
tgggagagtatggaagagtacgttaggtgtatacctaaggagtcctttgatggagccttt
tatcaatcattacttaacattcataatcactgcttcattgatgcacagaagtctattgat
aaagcaaggagttcactggatgctgaactgactgcactggttggtgagtcatacaacaga
gcctaccacttgatggtcagtgtgcagctactctctgaactggaggagatcatacagtgt
ctggtgagacctgagaagaagaaacagctacagaagacatggtggaacagattactgggt
tgccagcgtaacatggaggactggcagagaatacttcaagttcgatccctagtcctgaca
cagcaagaagagctaaagagttggatcaagtttgcatcaatttgtcgtaagagtggtaaa
ctggtcctctcagagaggacactgatcacactcctcagcaacgaccagtccttcaacatt
gatgctgatcctctctctgttaaattccctcaggtgactttggcatacatgaagcacaag
tggcacgctgatcaaaaacaggaagcatttcgtttgcttgaccagtttgtggttcgtctt
caaagtgataacatcgatccttctgcctctaatgaaaccaaccaacttttagcaaggtgt
tatttaaagctaggtgactggaaagctgaactaaacccagactcatcctctctcaccact
tccttcagttccatactccattattatgaactagcaacaaagtttgatcgccagtggtac
aaggcctggcatgcctgggcattcatgaacttccaagctttactccatcaaagacaagag
cagcaaaagcttcaaaagactaacgttatcttaagcgaagactctacctccagtgaatcc
actaataagattggaccagtagatatgacggcctccatacagtattccagtagtgcagtt
catggcttctttaggtctatatctctttcttctggtaactcactccaggacactctaagg
ctactgactttgtggtttgactatggtcacatctctgaggttcatgaagctcttgaggaa
ggaatcaaaacagtggatattgaaaactggctccaggtcattccccagttgatagctcgt
atagactcacctcgtagactggtctccaaacttattcatgagctactcactgacgtagga
cgacaccatcctcaggctttaatctacccattgacagtagctgctaagagccagagcact
gttagacgtgatgcagctgatatgattctgagtaacatgcgtgagcacagttctgatctg
gttcagcaagcagtgatggtatcagaggagctgataagagtggctatactctggcatgag
cagtggcacgagacattagaggatgcctcaaggatgtactttggtgagcacaatgttcaa
ggaatgttcaaggtcctagacccacttcatcagaagttggacaaaggcccagagacactt
aaagaaatctcctttaatcacgcttatggtcgggatttggcagaggcctcagagtggtgc
aagaagttccagaccagtagcaatgtgaaagacctcactcaggcctgggagctctattat
catgtctttagacgaatctctaagcaactgccacagcttaccacgttggagttacagtat
gtgtctcctaaactgttggcatgtaaagacttggaattagccattcctggaagctatgag
ccacactgtcccatcattcacatcaagagtgtctcctcatctctcaatgtcatcacttct
aagcagagaccaaggaaacttgtaatggaagggagtgatggtcggagttacatgttctta
ttgaaaggtcatgaggatctccgtcaggatgagagggtaatgcagctctttggtctggtc
aacacactactggacaatgacccagagacttttaaaagacacttgaggattcagagatat
tcagtaatccctctctctcctaattctggtctgattggttgggttcctcactgtgacact
atccatgctctgataagagactatagagacaagaagaagattatgctcaacattgagcat
cgcctaatgctacaaacatcatctgattatgatcatctcatgttaatgcagaaagttgaa
gtctttgaacaagccattaacagtactactggtgacgatttggctaaagtattgtggctc
aagagccccagctctgaagtttggtttgatagacgtaccaattacacacgctcactggct
gtaatgtcaatggttggctatgtactgggactgggtgacaggcatcccagtaatcttatg
ctggacagattgactggtcggatattacacattgattttggtgactgctttgaggtggct
atgacgagagagaaattcccagagaagataccttttagattaaccagaatgcttaccaat
gcaatggaggtgactggaatagagggtaacttcaggcggacctgttgctcagtgatgagg
gtccttagggataacaaggacagtgtcatggccgtcctggaagcttttgtctacgatcct
ctgcttaactggagactcatggatgataatggaaaggctaagagcaagcccatacctcag
caatctgacaccacaaccatcactaccagcaacgccaccactaacaacagcactggaaga
ttgttccctacacctggtgtggatgtccctgagtcccagcagtatcatcctgaggagctt
aaccgtaaagcactagccatcattgaaagagtccgacaaaaattaacaggaaatgatttc
cgtcatgagaagatgataaatgttgatcgacaggttcagctattaatagagcaggcgacg
agtcacgagaacctgtgccagtgttacattgggtggtgtcccttttggtag

DBGET integrated database retrieval system