KEGG   Amphimedon queenslandica (sponge): 100633443Help
Entry
100633443         CDS       T02284                                 

Definition
(RefSeq) serine/threonine-protein kinase mTOR-like
  KO
K07203  
serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Autophagy - other
Autophagy - animal
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100633443
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100633443
   04136 Autophagy - other eukaryotes
    100633443
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100633443
Protein kinases [BR:aqu01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   100633443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 1458 aa AA seqDB search
TFWAPDSPIQITIVLLVEKIILAMGDELKIYLPPMVQPVLRLFMQDQSEQKLVTQKMLCA
LQYCGSSLDDYLHLLVPAIVKVFQNPTNPIEARTIALETIEKLSSSLDFSDYCSQIIHAV
VDVLDTVPDLRGVAMDVLCSMMIQLGPRYKIFIQMVKKVLTKYRYSHAAYELLLCRLLKD
EPLTPDDDVERHIKSRKQQSTDDEAAEIEAVSFKKFSLDVNSLTKAWSTAGRISKDDWIE
WLRRLGVELLKESPSPSLRSCWALAQAYNPLARELFNAAFVSCWMELKSVHQEDLVVNLK
QFLTRDSIPEITQTVLNLAEFMEHCEEATGRFPLSSELLGECAMNCRAYAKALHYKEEDF
HRGVTPKLLESLIAINNKLQQPDAAVGVLMFAKERQQGDFKIQEEWYESLNDWEAALHLY
QTKQYSRPDDIKIALGRMRCLHAMGEWNRLYDIASEMWPLGDDDTRQQMSVMATAAAWGL
NQWESMEEYVRCIPKESFDGAFYQSLLNIHNHCFIDAQKSIDKARSSLDAELTALVGESY
NRAYHLMVSVQLLSELEEIIQCLVRPEKKKQLQKTWWNRLLGCQRNMEDWQRILQVRSLV
LTQQEELKSWIKFASICRKSGKLVLSERTLITLLSNDQSFNIDADPLSVKFPQVTLAYMK
HKWHADQKQEAFRLLDQFVVRLQSDNIDPSASNETNQLLARCYLKLGDWKAELNPDSSSL
TTSFSSILHYYELATKFDRQWYKAWHAWAFMNFQALLHQRQEQQKLQKTNVILSEDSTSS
ESTNKIGPVDMTASIQYSSSAVHGFFRSISLSSGNSLQDTLRLLTLWFDYGHISEVHEAL
EEGIKTVDIENWLQVIPQLIARIDSPRRLVSKLIHELLTDVGRHHPQALIYPLTVAAKSQ
STVRRDAADMILSNMREHSSDLVQQAVMVSEELIRVAILWHEQWHETLEDASRMYFGEHN
VQGMFKVLDPLHQKLDKGPETLKEISFNHAYGRDLAEASEWCKKFQTSSNVKDLTQAWEL
YYHVFRRISKQLPQLTTLELQYVSPKLLACKDLELAIPGSYEPHCPIIHIKSVSSSLNVI
TSKQRPRKLVMEGSDGRSYMFLLKGHEDLRQDERVMQLFGLVNTLLDNDPETFKRHLRIQ
RYSVIPLSPNSGLIGWVPHCDTIHALIRDYRDKKKIMLNIEHRLMLQTSSDYDHLMLMQK
VEVFEQAINSTTGDDLAKVLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYVLGLGDRHPSN
LMLDRLTGRILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGIEGNFRRTCCSV
MRVLRDNKDSVMAVLEAFVYDPLLNWRLMDDNGKAKSKPIPQQSDTTTITTSNATTNNST
GRLFPTPGVDVPESQQYHPEELNRKALAIIERVRQKLTGNDFRHEKMINVDRQVQLLIEQ
ATSHENLCQCYIGWCPFW
NT seq 4377 nt NT seq  +upstreamnt  +downstreamnt
acattctgggcccctgacagtccaatacagatcacaatagtgctcttagttgagaagatc
atactagcaatgggagacgagttgaagatatacctccccccaatggtacagccagtactt
cgtctctttatgcaagatcagagcgaacagaagcttgttactcaaaagatgctttgtgct
cttcaatattgtggctctagtttagatgattaccttcatttgctagttccagcaattgtt
aaagtttttcagaatccaactaacccaatagaagcaagaactatagcactggagactatt
gagaaactgagtagttcccttgacttctctgattattgttctcagatcattcatgctgtc
gttgatgttttagatactgtccctgatctacgtggtgtggctatggacgtcctttgttca
atgatgattcagttaggaccacgctacaagatattcattcaaatggtgaaaaaggtatta
acaaagtatcgttactctcatgctgcctatgagctcctgttgtgtagactattaaaagat
gagccactcactcctgatgatgatgtagagcgacacatcaaatcaaggaagcagcaaagc
actgatgatgaagcagcagagattgaggcagtgtcttttaagaagttttcacttgacgtg
aactccttaacaaaagcctggagcactgctggtaggatatcaaaggatgattggattgaa
tggctgagaagattaggagttgaactattaaaggagagcccctctccttcattaagatcc
tgctgggcactggctcaagcttacaatccactggccagggaattattcaatgccgccttt
gtatcatgctggatggaattaaagtctgtccatcaagaggatctggtggttaatttgaag
cagttcctcactagggacagtatccctgagataactcaaactgtccttaacttagccgag
ttcatggagcactgtgaggaggccactggacggtttcctctaagctcagaactattagga
gagtgtgctatgaattgtagagcctatgctaaggctcttcactacaaggaagaggacttt
catcgtggagtgacaccaaagctactagagtcactgattgctattaataataagctccaa
cagcctgatgctgctgtgggtgtactgatgtttgctaaggaaagacagcaaggagacttt
aaaatccaagaggagtggtatgagagtctcaatgattgggaagcagctcttcacttgtat
cagaccaagcagtacagtagacctgatgatatcaagatagccctgggccgaatgaggtgc
cttcatgctatgggagaatggaatcgtttgtacgacatagcaagtgagatgtggccatta
ggagatgatgacactcgccagcagatgtcagtaatggcgactgcagcagcctggggcctc
aaccagtgggagagtatggaagagtacgttaggtgtatacctaaggagtcctttgatgga
gccttttatcaatcattacttaacattcataatcactgcttcattgatgcacagaagtct
attgataaagcaaggagttcactggatgctgaactgactgcactggttggtgagtcatac
aacagagcctaccacttgatggtcagtgtgcagctactctctgaactggaggagatcata
cagtgtctggtgagacctgagaagaagaaacagctacagaagacatggtggaacagatta
ctgggttgccagcgtaacatggaggactggcagagaatacttcaagttcgatccctagtc
ctgacacagcaagaagagctaaagagttggatcaagtttgcatcaatttgtcgtaagagt
ggtaaactggtcctctcagagaggacactgatcacactcctcagcaacgaccagtccttc
aacattgatgctgatcctctctctgttaaattccctcaggtgactttggcatacatgaag
cacaagtggcacgctgatcaaaaacaggaagcatttcgtttgcttgaccagtttgtggtt
cgtcttcaaagtgataacatcgatccttctgcctctaatgaaaccaaccaacttttagca
aggtgttatttaaagctaggtgactggaaagctgaactaaacccagactcatcctctctc
accacttccttcagttccatactccattattatgaactagcaacaaagtttgatcgccag
tggtacaaggcctggcatgcctgggcattcatgaacttccaagctttactccatcaaaga
caagagcagcaaaagcttcaaaagactaacgttatcttaagcgaagactctacctccagt
gaatccactaataagattggaccagtagatatgacggcctccatacagtattccagtagt
gcagttcatggcttctttaggtctatatctctttcttctggtaactcactccaggacact
ctaaggctactgactttgtggtttgactatggtcacatctctgaggttcatgaagctctt
gaggaaggaatcaaaacagtggatattgaaaactggctccaggtcattccccagttgata
gctcgtatagactcacctcgtagactggtctccaaacttattcatgagctactcactgac
gtaggacgacaccatcctcaggctttaatctacccattgacagtagctgctaagagccag
agcactgttagacgtgatgcagctgatatgattctgagtaacatgcgtgagcacagttct
gatctggttcagcaagcagtgatggtatcagaggagctgataagagtggctatactctgg
catgagcagtggcacgagacattagaggatgcctcaaggatgtactttggtgagcacaat
gttcaaggaatgttcaaggtcctagacccacttcatcagaagttggacaaaggcccagag
acacttaaagaaatctcctttaatcacgcttatggtcgggatttggcagaggcctcagag
tggtgcaagaagttccagaccagtagcaatgtgaaagacctcactcaggcctgggagctc
tattatcatgtctttagacgaatctctaagcaactgccacagcttaccacgttggagtta
cagtatgtgtctcctaaactgttggcatgtaaagacttggaattagccattcctggaagc
tatgagccacactgtcccatcattcacatcaagagtgtctcctcatctctcaatgtcatc
acttctaagcagagaccaaggaaacttgtaatggaagggagtgatggtcggagttacatg
ttcttattgaaaggtcatgaggatctccgtcaggatgagagggtaatgcagctctttggt
ctggtcaacacactactggacaatgacccagagacttttaaaagacacttgaggattcag
agatattcagtaatccctctctctcctaattctggtctgattggttgggttcctcactgt
gacactatccatgctctgataagagactatagagacaagaagaagattatgctcaacatt
gagcatcgcctaatgctacaaacatcatctgattatgatcatctcatgttaatgcagaaa
gttgaagtctttgaacaagccattaacagtactactggtgacgatttggctaaagtattg
tggctcaagagccccagctctgaagtttggtttgatagacgtaccaattacacacgctca
ctggctgtaatgtcaatggttggctatgtactgggactgggtgacaggcatcccagtaat
cttatgctggacagattgactggtcggatattacacattgattttggtgactgctttgag
gtggctatgacgagagagaaattcccagagaagataccttttagattaaccagaatgctt
accaatgcaatggaggtgactggaatagagggtaacttcaggcggacctgttgctcagtg
atgagggtccttagggataacaaggacagtgtcatggccgtcctggaagcttttgtctac
gatcctctgcttaactggagactcatggatgataatggaaaggctaagagcaagcccata
cctcagcaatctgacaccacaaccatcactaccagcaacgccaccactaacaacagcact
ggaagattgttccctacacctggtgtggatgtccctgagtcccagcagtatcatcctgag
gagcttaaccgtaaagcactagccatcattgaaagagtccgacaaaaattaacaggaaat
gatttccgtcatgagaagatgataaatgttgatcgacaggttcagctattaatagagcag
gcgacgagtcacgagaacctgtgccagtgttacattgggtggtgtcccttttggtag

DBGET integrated database retrieval system