KEGG   Amphimedon queenslandica (sponge): 100633634Help
Entry
100633634         CDS       T02284                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial-like
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100633634
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100633634
  Amino acid metabolism
   00310 Lysine degradation
    100633634
Enzymes [BR:aqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100633634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 428 aa AA seqDB search
MFCLRGRELLPRLLHRHSSCLAPGKLRSNVVTASHIGNEYKIVNTPAFAESISEGDVKWD
KNVGDFVKEDEIIAEIETDKTAIPIPSPVFGIIEEIFVPDGEKVVAGDQLCKIKVSAEAP
PPTASPPTPKESATPPPPPPSPPSAPPPPSAPSAAGPIPTTPPPPPPLPTMPLGNIPPPP
PLPSFSAPSQSVGVVSRSEKRTKMSRMRQRIAERLKEAQNVNAMLTTFNEVDMSSVIELR
KKFQDAFVKKHGIKLGFMSPFVKAACSALEDQPVVNAVIDNNEIIYRDYIDISVAVATPK
GLVVPVVRNVNVMNYADIEKEIASLGQKVFSGALAVEDMDGGTFTISNGGVYGSMFGTPI
INPPQSAILGMHGVFDRPVAIEGKVEIRPMMYIALTYDHRLIDGREAVLFLRKIKSGVED
PRSLLLDL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgttttgtctcagagggagagaactgctaccaaggctactccacaggcacagttcctgt
ctggctcctggaaagctaagatctaatgttgtgactgcttctcatattggtaatgagtat
aagatagttaatactcctgcatttgctgagtcaatctcggagggcgatgtaaagtgggac
aaaaatgttggcgattttgttaaagaagacgaaattatagcagagattgaaactgataag
actgctattcctataccttcccctgtgtttggaatcattgaagaaatatttgtacctgac
ggggagaaagtggtagctggggaccagctatgcaaaataaaagtatcagctgaagcacct
cctccaacagcatcacctcctacacccaaagaaagtgccacacctcctcctccccctcct
tcccctccctctgctcctcctcctccttctgccccttctgctgctggtcctataccaact
acgcctcccccacctcctcctttaccaacaatgccattaggtaatattcctcctcctcct
cctcttccgtcattttctgctccctctcagtctgtgggtgtggtcagtcgttcggagaaa
agaacaaagatgtcaaggatgagacagaggatagccgagaggctcaaggaggcacagaat
gtcaatgcaatgctcaccactttcaacgaagtggacatgtctagcgtcattgagcttagg
aagaagtttcaagacgcatttgtaaagaagcatggtatcaagcttggattcatgtcgcca
tttgtaaaggcagcttgctcagcacttgaggatcaaccagtagtaaatgcagttattgat
aataatgaaatcatctatagagattacattgatatcagtgttgcagtagctacaccaaag
ggtttagttgttcctgttgtaagaaatgtcaatgttatgaattatgctgacattgaaaaa
gagattgcaagcctgggacaaaaggtattttctggtgcattggcagtagaggatatggat
ggaggtactttcactatcagtaacggaggagtgtatggctcaatgtttggtacaccaatc
attaatccaccacagtcagccatactgggcatgcacggggtctttgatagacctgttgct
attgaaggaaaagttgagattcgcccaatgatgtatatagcactaacctatgatcataga
ttaattgatggtcgtgaagctgtgctcttccttaggaaaatcaagtcaggagttgaagac
ccacgcagtctgttattagacctttag

DBGET integrated database retrieval system