KEGG   Amphimedon queenslandica (sponge): 100633634Help
Entry
100633634         CDS       T02284                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial-like
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:aqu01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:aqu00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:aqu00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 428 aa AA seqDB search
MFCLRGRELLPRLLHRHSSCLAPGKLRSNVVTASHIGNEYKIVNTPAFAESISEGDVKWD
KNVGDFVKEDEIIAEIETDKTAIPIPSPVFGIIEEIFVPDGEKVVAGDQLCKIKVSAEAP
PPTASPPTPKESATPPPPPPSPPSAPPPPSAPSAAGPIPTTPPPPPPLPTMPLGNIPPPP
PLPSFSAPSQSVGVVSRSEKRTKMSRMRQRIAERLKEAQNVNAMLTTFNEVDMSSVIELR
KKFQDAFVKKHGIKLGFMSPFVKAACSALEDQPVVNAVIDNNEIIYRDYIDISVAVATPK
GLVVPVVRNVNVMNYADIEKEIASLGQKVFSGALAVEDMDGGTFTISNGGVYGSMFGTPI
INPPQSAILGMHGVFDRPVAIEGKVEIRPMMYIALTYDHRLIDGREAVLFLRKIKSGVED
PRSLLLDL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgttttgtctcagagggagagaactgctaccaaggctactccacaggcacagttcctgt
ctggctcctggaaagctaagatctaatgttgtgactgcttctcatattggtaatgagtat
aagatagttaatactcctgcatttgctgagtcaatctcggagggcgatgtaaagtgggac
aaaaatgttggcgattttgttaaagaagacgaaattatagcagagattgaaactgataag
actgctattcctataccttcccctgtgtttggaatcattgaagaaatatttgtacctgac
ggggagaaagtggtagctggggaccagctatgcaaaataaaagtatcagctgaagcacct
cctccaacagcatcacctcctacacccaaagaaagtgccacacctcctcctccccctcct
tcccctccctctgctcctcctcctccttctgccccttctgctgctggtcctataccaact
acgcctcccccacctcctcctttaccaacaatgccattaggtaatattcctcctcctcct
cctcttccgtcattttctgctccctctcagtctgtgggtgtggtcagtcgttcggagaaa
agaacaaagatgtcaaggatgagacagaggatagccgagaggctcaaggaggcacagaat
gtcaatgcaatgctcaccactttcaacgaagtggacatgtctagcgtcattgagcttagg
aagaagtttcaagacgcatttgtaaagaagcatggtatcaagcttggattcatgtcgcca
tttgtaaaggcagcttgctcagcacttgaggatcaaccagtagtaaatgcagttattgat
aataatgaaatcatctatagagattacattgatatcagtgttgcagtagctacaccaaag
ggtttagttgttcctgttgtaagaaatgtcaatgttatgaattatgctgacattgaaaaa
gagattgcaagcctgggacaaaaggtattttctggtgcattggcagtagaggatatggat
ggaggtactttcactatcagtaacggaggagtgtatggctcaatgtttggtacaccaatc
attaatccaccacagtcagccatactgggcatgcacggggtctttgatagacctgttgct
attgaaggaaaagttgagattcgcccaatgatgtatatagcactaacctatgatcataga
ttaattgatggtcgtgaagctgtgctcttccttaggaaaatcaagtcaggagttgaagac
ccacgcagtctgttattagacctttag

DBGET integrated database retrieval system