KEGG   Amphimedon queenslandica (sponge): 100633634Help
Entry
100633634         CDS       T02284                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial-like
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100633634
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100633634
  Amino acid metabolism
   00310 Lysine degradation
    100633634
Enzymes [BR:aqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100633634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 428 aa AA seqDB search
MFCLRGRELLPRLLHRHSSCLAPGKLRSNVVTASHIGNEYKIVNTPAFAESISEGDVKWD
KNVGDFVKEDEIIAEIETDKTAIPIPSPVFGIIEEIFVPDGEKVVAGDQLCKIKVSAEAP
PPTASPPTPKESATPPPPPPSPPSAPPPPSAPSAAGPIPTTPPPPPPLPTMPLGNIPPPP
PLPSFSAPSQSVGVVSRSEKRTKMSRMRQRIAERLKEAQNVNAMLTTFNEVDMSSVIELR
KKFQDAFVKKHGIKLGFMSPFVKAACSALEDQPVVNAVIDNNEIIYRDYIDISVAVATPK
GLVVPVVRNVNVMNYADIEKEIASLGQKVFSGALAVEDMDGGTFTISNGGVYGSMFGTPI
INPPQSAILGMHGVFDRPVAIEGKVEIRPMMYIALTYDHRLIDGREAVLFLRKIKSGVED
PRSLLLDL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgttttgtctcagagggagagaactgctaccaaggctactccacaggcacagttcctgt
ctggctcctggaaagctaagatctaatgttgtgactgcttctcatattggtaatgagtat
aagatagttaatactcctgcatttgctgagtcaatctcggagggcgatgtaaagtgggac
aaaaatgttggcgattttgttaaagaagacgaaattatagcagagattgaaactgataag
actgctattcctataccttcccctgtgtttggaatcattgaagaaatatttgtacctgac
ggggagaaagtggtagctggggaccagctatgcaaaataaaagtatcagctgaagcacct
cctccaacagcatcacctcctacacccaaagaaagtgccacacctcctcctccccctcct
tcccctccctctgctcctcctcctccttctgccccttctgctgctggtcctataccaact
acgcctcccccacctcctcctttaccaacaatgccattaggtaatattcctcctcctcct
cctcttccgtcattttctgctccctctcagtctgtgggtgtggtcagtcgttcggagaaa
agaacaaagatgtcaaggatgagacagaggatagccgagaggctcaaggaggcacagaat
gtcaatgcaatgctcaccactttcaacgaagtggacatgtctagcgtcattgagcttagg
aagaagtttcaagacgcatttgtaaagaagcatggtatcaagcttggattcatgtcgcca
tttgtaaaggcagcttgctcagcacttgaggatcaaccagtagtaaatgcagttattgat
aataatgaaatcatctatagagattacattgatatcagtgttgcagtagctacaccaaag
ggtttagttgttcctgttgtaagaaatgtcaatgttatgaattatgctgacattgaaaaa
gagattgcaagcctgggacaaaaggtattttctggtgcattggcagtagaggatatggat
ggaggtactttcactatcagtaacggaggagtgtatggctcaatgtttggtacaccaatc
attaatccaccacagtcagccatactgggcatgcacggggtctttgatagacctgttgct
attgaaggaaaagttgagattcgcccaatgatgtatatagcactaacctatgatcataga
ttaattgatggtcgtgaagctgtgctcttccttaggaaaatcaagtcaggagttgaagac
ccacgcagtctgttattagacctttag

DBGET integrated database retrieval system