KEGG   Amphimedon queenslandica (sponge): 100633642Help
Entry
100633642         CDS       T02284                                 

Definition
histone-lysine N-methyltransferase SETD2-like
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100633642
Enzymes [BR:aqu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100633642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 862 aa AA seqDB search
MSDEVTFETVVESPKPLTEPSEKDGFVSQHISAKSMPLEGDDSSPPSFDFITENVYIVER
GTTRDGKRSKRMMCTCQFDPETDNHSEACGENCLNRLLMIECGSRCPCGEYCTNKRFTRS
SYANVEVIKTEMKGWGLKATCDISRYSFVMEYCGEVCSLEEFERRRNIYEKESRRHYYFM
SLKTDEILDATRKGNLSRFINHSCEPNCETQKWTVNGRLRVGFFALRHIPAGEELTFDYQ
FQRFGESVQKCYCGSETCRGFLGAKQTTDVVRSDMYFPTRDRKAKRRCDDADSMFEKEIY
DVVGSTWRLKNSDQVLSLSRLMLRAESIKQRRMLLKVLQATKDNACLKRFLSFQGLRLLW
SWMVEVTDQQTSEALDAKIQILLTLQSLPVPNRNVLKDNKIWQLVQKWSEPSIPSNSHNQ
DSVVIREADCSISQDNIDGENKHLEDCPEKVVKVEAEILETHSDLLSEAESREAVASFED
EESRVVSIANDLLEKWNSLKEVFRIPKKILSDDVRSKEKKVEESDEDNRRKRKRESKWDT
SEGYQPTNTFTRPGEKVSQSYYVPQSRPPARTGLLGPPPPSIAGLPLQNTVIVQHQSGQS
VYVQQQIFPTPSNFPQGMLAAQYAPVNFPPPTLPLPVINLDSAPLPVTSMQSQLLEVTPK
PTLEPSNSLIPPTVRNAAANVSATIPPPPPVEKPLPQNWKEVKEPSGKVYYYHTITRKTQ
WERPTEEDIDEDEEDDDNNSVESAHEGQPHTPEGSPPSLTPNQESTESRRQSTAKDSFKH
SLSKLVVRCLDHHRKPTCKYGRITCSEDFKHLARKLTFGITEKEITRRGSADALEFNDQV
KSRTKTYIKNYMKKFGPIYSHS
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgaagttacctttgaaactgtcgtggagagccctaaacctcttactgaacct
tctgagaaggatggttttgtatctcaacatataagcgctaaaagtatgcctttagaaggt
gacgatagttctcctccctcttttgactttatcactgaaaatgtttatattgttgaaagg
ggaacaactcgtgatggaaagagaagcaagcgaatgatgtgtacctgtcagtttgaccca
gaaactgataatcactctgaagcttgtggtgaaaactgtctaaacagattgttaatgata
gaatgtggttctcgttgcccctgtggtgaatactgtactaataaaagatttacaagatca
agctatgccaatgtcgaagttattaaaactgaaatgaagggctggggattaaaagctacc
tgtgatatttctcggtattcatttgttatggaatactgtggcgaagtgtgtagccttgaa
gaatttgaaagaagaagaaacatatatgaaaaggaaagcagaagacattattattttatg
tcactgaaaacagatgagatacttgacgctacaaggaaaggaaatctctcccgatttatt
aatcatagctgtgagcctaactgtgaaactcaaaagtggactgttaatggacggctaaga
gttggattttttgctttaagacatatacctgctggagaagaactcacttttgattatcag
tttcaacgttttggagaatctgttcaaaaatgttattgtggtagtgaaacttgcagaggc
ttcttaggagcgaagcagactactgatgttgtgcgtagtgacatgtattttcctacacgg
gacaggaaagcaaagcgtcgttgtgatgatgctgattcaatgtttgaaaaagaaatatat
gatgttgtgggaagcacatggcgtctcaagaactcagaccaggttctatcattatctcgc
ctcatgctaagagcagagtcaatcaagcagagaagaatgcttttaaaagttcttcaggct
accaaagacaatgcatgtttaaagcggttcctgtcatttcaagggttaagattattatgg
agttggatggtagaagtaacagatcagcaaacttctgaagccttagatgctaaaatacag
attttattgacgctgcaatcattacctgtaccaaatagaaatgtgcttaaggacaataaa
atttggcagttagtacaaaaatggtctgagccaagtattccttctaattcacacaatcaa
gacagtgttgtcattcgtgaagctgactgttcaattagccaagataatatagatggagaa
aataagcatttagaggattgcccagaaaaggttgtaaaagtagaggctgagattttagaa
acacatagtgacctgttgtctgaagctgaaagtagagaagctgtagcttcttttgaagat
gaagaatcaagagtagttagtatagcaaatgatctcctagaaaagtggaattcattaaaa
gaagtgtttagaataccaaagaaaatactttcggatgatgtccgatcgaaggagaaaaaa
gtggaagagagcgatgaagacaacaggagaaagcgcaagagagaaagtaaatgggacacc
agtgaaggatatcaaccaacaaacacattcaccagacctggagaaaaagtgtcacaatca
tattatgtaccccaatcccgcccaccagcgagaactggtttattaggccctcctcctcca
tctattgctggacttcctttacaaaatactgtcattgttcagcaccagtcaggacaaagt
gtttatgttcagcagcaaatattccctacaccctcaaattttccacaaggcatgctagca
gcacagtatgctcctgtcaatttccctcctccaacattacctttacctgttattaatttg
gattctgctcctctgccagtaacgtctatgcaatctcagttacttgaagttactcctaaa
cctactcttgaacctagtaatagtttaataccacccacagttaggaacgctgcagcaaat
gtctcagccacaatccccccaccacctcctgtcgagaaaccattgccacaaaactggaag
gaagtaaaggagccttctggaaaggtgtattactaccacaccataactcgtaaaacgcaa
tgggaacgtccaactgaagaagacatcgatgaagatgaagaagatgatgacaataacagt
gtcgagtcagcacatgaaggacagcctcatactccagaaggatccccaccttcattgact
ccaaatcaggaaagcactgaaagtagaaggcaatcaacagcaaaagattcattcaaacat
tcgctatcaaaactggttgtgagatgtttggaccatcatcgtaaacctacttgcaaatat
ggacgtattacttgttctgaagattttaaacacttagctagaaagctgacatttggtatc
actgagaaagagatcacaagacgtggcagtgctgatgcacttgaatttaatgatcaggtg
aagtctcgtactaaaacatatatcaagaactatatgaaaaagtttggtcctatatatagt
cactcatag

DBGET integrated database retrieval system