KEGG   Amphimedon queenslandica (sponge): 100633667Help
Entry
100633667         CDS       T02284                                 

Definition
histone acetyltransferase KAT5-like
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100633667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 461 aa AA seqDB search
MVIHNLKRNIEGCQLPVCLRSETMDEEEWPMAEIISKKCDSNGQWRFYVHYNSYNKRLDE
WVTADKLDIDHIQLPRKESKSQTSTAAAALIKNTSRAVSPDVTISGASSPLPSSGETVIS
SSRRSSVALGRKRKNENDNSSEPVGGESSPAQLPPQTGSMHRPIGTHASDDVVTRMKNIE
MLELGRHRIKPWYFSPYPQELTTEPVIYLCEFCLKYMKSLTCLARHRTKCNIFHPPGNEI
YRKDTISFFEIDGRKNKAYSQNLCLLAKLFLDHKTLYYDTDPFLFYIMTEYDEHGFHIVG
YFSKEKESSEDYNVACILTLPCYQRKGYGKLLIEFSYELSKIEGKTGSPEKPLSDLGLLS
YRSYWTQTLLEVLINMKNQEDETIPFVTINELCEQTSIRKDDVTSTLQYHNLIHYYKGQY
VISLSNEILEHHERSMAKRKIRIDPKCIQWTPKDWSRRGKW
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggtaatacataacttaaagaggaatattgaaggatgtcaactgccggtgtgcttgaga
tcagaaacaatggacgaagaggaatggccaatggccgagataattagtaagaaatgtgac
tctaacggtcagtggaggttctatgtccattacaatagctacaataagaggctggacgaa
tgggttactgcagataaacttgacatcgatcacatacaattacctcgtaaagagtcaaag
tcccagacctccactgcagcagctgctctcattaagaacacatcacgggcagtgtcgcct
gatgtaactatatctggagcaagctctccacttccgtcctccggagagactgtcattagt
agcagtagaaggtcctcggtagctttgggaaggaagaggaagaatgagaatgataattcc
tctgagccagttggaggtgaatccagtccagctcagctccctcctcaaactggtagcatg
catcgaccaataggaactcacgcgagtgacgacgttgtcacgagaatgaagaatattgag
atgctcgagttgggaaggcacaggataaagccgtggtacttctctccctatcctcaagag
ctcactacagagccggttatttatttgtgtgagttttgtcttaaatacatgaagagcttg
acatgtcttgcaagacacagaacaaagtgtaatatcttccatcctcctggaaatgaaata
tacagaaaagacacaatctctttttttgagattgatggtcggaaaaacaaagcttactct
caaaatttgtgtctgcttgcgaagttatttttggaccacaagacactgtactatgacaca
gacccgttcctgttctatataatgacagagtatgatgagcatgggtttcatatagtgggc
tacttttctaaagagaaagagagttcagaagattacaatgttgcttgtattcttacattg
ccttgctaccagagaaaaggctacgggaaattactgatagaatttagttatgagctctca
aagattgagggtaaaactggttcacccgagaagccgctctcagatcttggtctcttgtca
tatcggagctactggactcagacactacttgaagtcttgatcaacatgaagaaccaagaa
gacgagacgataccttttgtgacaatcaatgagctctgtgaacagacaagtatacgtaaa
gatgacgtcacgtctactcttcagtatcacaacctcatccattactacaagggacagtac
gtcatcagtctctctaatgaaatactggagcatcacgagcgctcgatggcaaagaggaaa
atacgcattgatccaaagtgcatacaatggacaccaaaggattggagtaggagggggaag
tggtga

DBGET integrated database retrieval system