KEGG   Amphimedon queenslandica (sponge): 100633766Help
Entry
100633766         CDS       T02284                                 

Definition
glutathione S-transferase Mu 3-like
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100633766
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100633766
   00982 Drug metabolism - cytochrome P450
    100633766
Enzymes [BR:aqu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100633766
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 230 aa AA seqDB search
MAEPQQKKSKSLQIGYWSIRGLAQPIRLLLKYAGIEFENVTYTQAEAPSFSREGWLSVKH
TLGLPFPNLPYLIDGDVKITQTNAILTYLGRKANLYGKTEADMATVDMLLNVAMDFRNGF
VRLCYSSQMESMKEEYLKTVRAKLEEMSKYLGDKPWFAGNEITFPDFHFYEMFDQHKEFH
PQLFDGLDNLKAYMDRFEALPAIKSYMDSPEFIRWPINNPIAQWRGNKKL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacctcaacagaaaaagtctaaatctctacaaataggctattggagcatcaga
gggctagcacagccaattcgtcttctcctaaagtatgctggtatagagtttgaaaatgtg
acctacacacaagctgaagctcctagtttttccagagaaggatggctttcagtaaagcac
actttaggactaccttttccaaacttaccatatctaattgatggtgatgtgaagattaca
cagaccaacgcaatcttaacctatcttggacgcaaggctaatctctatggtaaaacagaa
gctgatatggctacagttgacatgcttctcaatgtggctatggacttccgaaatggattt
gttagactttgctatagttcacaaatggaatcgatgaaagaagaatatttaaaaactgtt
cgggctaagcttgaggaaatgtccaagtacttgggagataaaccttggtttgctggaaat
gagatcacttttcccgactttcatttttatgaaatgtttgaccaacacaaggagttccat
cctcagttatttgatggtcttgacaatcttaaggcttatatggatcgctttgaggctctt
cctgctataaagagttatatggactctcctgaatttattcgttggccaatcaacaaccca
atagctcaatggcgtggaaacaaaaaactttaa

DBGET integrated database retrieval system