KEGG   Amphimedon queenslandica (sponge): 100633811Help
Entry
100633811         CDS       T02284                                 

Definition
cyclin-H-like
Orthology
K06634  
cyclin H
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100633811
  Replication and repair
   03420 Nucleotide excision repair
    100633811
Transcription machinery [BR:aqu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100633811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 262 aa AA seqDB search
MFHSSTQKSHWLFQHRQQLTRQRAETNASFCRKYSDAAISKECQFLTPTEEESVCLYYMK
KLFEFCNVFRPPVPRGVLGTAGAYFKRFYLLTSVMDYHPKEIFLSCAYLAFKIEEYNVSL
DEFVYMLSPELRQSSSEMILNNELMMLKRLKFHLTIHSPFRPLEGFLIDMKTRSSIPNVE
RLRKEADSFLMSSLYSDVLFLYPPSQIALAALYYASTVIEVDISSKRKSDEVSEVVLRKK
IKEEHDVEETGLTSLTGFGSLT
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtttcatagcagtacacagaagtcccattggcttttccagcacagacagcagcttacc
cgccaaagagcagaaaccaatgcatctttctgtcgcaaatactcagatgctgctatcagc
aaagaatgtcagttcctgacccccacagaagaagaatcagtctgcctctattacatgaaa
aaactttttgaattttgcaacgtgttccggcctccggtccctagaggggttctgggtaca
gctggggcatatttcaaacgtttctatctcctcacttcagtaatggactatcatccgaaa
gaaatatttttgtcctgtgcgtatttggcatttaagattgaggagtacaatgtgtcactt
gacgagtttgtctacatgctatctccggaattacgtcagtccagctctgagatgatactc
aataatgaattaatgatgctgaaaaggctcaagtttcacttgacgattcattcacctttt
agaccactggaaggattcttgattgatatgaagacgaggtcctctattcctaatgtggag
cgtctccgtaaagaagcagactcattcctaatgagtagcttatactctgatgttttattt
ctatatccaccatcacaaatagctttggctgctttatactatgcttctactgtcattgaa
gtggatatatcaagcaagagaaaaagtgatgaagtatctgaagtagtattaaggaagaaa
attaaggaggagcatgacgtagaagaaactggtctgacgagtttgactggttttggatca
ttaacatga

DBGET integrated database retrieval system