KEGG   Amphimedon queenslandica (sponge): 100633874Help
Entry
100633874         CDS       T02284                                 

Definition
phospholipase B1, membrane-associated-like
Organism
aqu  Amphimedon queenslandica (sponge)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 458 aa AA seqDB search
MEVHYLLVLLSLSGLLSFAVAVEDGYEERLREALKKAQEQVNASNATLGATCYKRFGHNF
DCELFPHDKKEPATVHELTPYDISYIGALGDSITAAMGSAACTVLDDLISYRGQSWTIGG
RLDLKKITSIPNILRKYNPNLKGFSTGNGGPNSGNAKNNVAVIGAIAQDMPDQAKELVKR
MKESMDDFNNKWKLVSLWIGGNNLCSYCKKREKHSPENYVNSITAALDILKEELPRTFVN
LIQIIDVTRLEPLKGPICDLVHYAVCECTLKDLEETSRASTEYQEGLADLVNSGRYDDRD
DFTVVLQPFMEGVELPRLDNGKPDFSYFAPDCFHFSSKGHMEGAIALWKNMFEPVGSKTS
GWDLPGKLYCPTEDNKYLFTKKNSPPPSLFGQSGTEQSAGVTTEGDKATHSASIAVSASI
GAVSLLVVVIIVIVIAFKLRNKRRARGIGEQIPLFSNN
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggaagtccattatttgctggttttgctctcactttcaggcctcctgtcatttgcagta
gctgttgaagatggctatgaagagagactaagagaagctcttaagaaagcacaggaacag
gtcaatgctagtaatgctacacttggtgccacttgctataaaagatttgggcacaatttt
gactgtgagctatttcctcatgacaaaaaggagccagcaactgtccacgagttgactcct
tatgatatcagctatattggtgctcttggagattccataacagctgcaatgggctctgct
gcttgcactgtccttgatgatttgataagctatcgtggacagtcatggactattggtggg
cgcttggatttgaaaaaaatcacttccattccaaatattcttcgcaagtataatcctaac
ttaaagggtttctctactgggaatggtggaccaaactctgggaatgcaaagaacaatgta
gcggtcataggagccatagctcaagatatgcctgaccaagctaaagaactagttaagcgt
atgaaagagagcatggatgacttcaataacaagtggaagcttgtctctttgtggattggt
ggcaacaacctctgttcttactgcaaaaaaagagaaaaacattctcctgagaactatgtc
aatagcatcaccgcagcacttgatattttaaaggaagagcttccaaggacttttgttaac
ctcatccaaattattgatgtgactcgcttggagcctctaaaaggacccatctgtgatctt
gttcactatgctgtatgtgaatgcacactaaaagatttagaggaaaccagtagagcatca
actgaatatcaagaaggccttgctgatcttgtcaactctggtcgctatgatgacagagat
gacttcacagttgtgttgcagccatttatggaaggagtggagctaccaagattagataac
ggcaagcctgattttagctattttgcgcccgactgctttcattttagtagcaaggggcac
atggaaggggcaattgcactgtggaagaatatgtttgaaccagttggcagcaagacctca
ggctgggatctacctggaaaactgtactgtccaacagaggataacaagtacttatttact
aagaagaatagtcctccaccttcattatttggtcagtcaggaactgagcagtctgctggt
gttactactgaaggtgataaagctacacactccgcttcaattgctgtcagtgcaagcatt
ggtgctgtgtctttgcttgttgttgtaataattgtaatagttattgcttttaaactacgc
aataaaagaagagcaagaggaattggagagcaaataccgttgtttagcaataactga

DBGET integrated database retrieval system