KEGG   Amphimedon queenslandica (sponge): 100633874Help
Entry
100633874         CDS       T02284                                 

Definition
(RefSeq) phospholipase B1, membrane-associated-like
  KO
K14621  
phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100633874
   00565 Ether lipid metabolism
    100633874
   00590 Arachidonic acid metabolism
    100633874
   00591 Linoleic acid metabolism
    100633874
   00592 alpha-Linolenic acid metabolism
    100633874
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100633874
    3.1.1.5  lysophospholipase
     100633874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 458 aa AA seqDB search
MEVHYLLVLLSLSGLLSFAVAVEDGYEERLREALKKAQEQVNASNATLGATCYKRFGHNF
DCELFPHDKKEPATVHELTPYDISYIGALGDSITAAMGSAACTVLDDLISYRGQSWTIGG
RLDLKKITSIPNILRKYNPNLKGFSTGNGGPNSGNAKNNVAVIGAIAQDMPDQAKELVKR
MKESMDDFNNKWKLVSLWIGGNNLCSYCKKREKHSPENYVNSITAALDILKEELPRTFVN
LIQIIDVTRLEPLKGPICDLVHYAVCECTLKDLEETSRASTEYQEGLADLVNSGRYDDRD
DFTVVLQPFMEGVELPRLDNGKPDFSYFAPDCFHFSSKGHMEGAIALWKNMFEPVGSKTS
GWDLPGKLYCPTEDNKYLFTKKNSPPPSLFGQSGTEQSAGVTTEGDKATHSASIAVSASI
GAVSLLVVVIIVIVIAFKLRNKRRARGIGEQIPLFSNN
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggaagtccattatttgctggttttgctctcactttcaggcctcctgtcatttgcagta
gctgttgaagatggctatgaagagagactaagagaagctcttaagaaagcacaggaacag
gtcaatgctagtaatgctacacttggtgccacttgctataaaagatttgggcacaatttt
gactgtgagctatttcctcatgacaaaaaggagccagcaactgtccacgagttgactcct
tatgatatcagctatattggtgctcttggagattccataacagctgcaatgggctctgct
gcttgcactgtccttgatgatttgataagctatcgtggacagtcatggactattggtggg
cgcttggatttgaaaaaaatcacttccattccaaatattcttcgcaagtataatcctaac
ttaaagggtttctctactgggaatggtggaccaaactctgggaatgcaaagaacaatgta
gcggtcataggagccatagctcaagatatgcctgaccaagctaaagaactagttaagcgt
atgaaagagagcatggatgacttcaataacaagtggaagcttgtctctttgtggattggt
ggcaacaacctctgttcttactgcaaaaaaagagaaaaacattctcctgagaactatgtc
aatagcatcaccgcagcacttgatattttaaaggaagagcttccaaggacttttgttaac
ctcatccaaattattgatgtgactcgcttggagcctctaaaaggacccatctgtgatctt
gttcactatgctgtatgtgaatgcacactaaaagatttagaggaaaccagtagagcatca
actgaatatcaagaaggccttgctgatcttgtcaactctggtcgctatgatgacagagat
gacttcacagttgtgttgcagccatttatggaaggagtggagctaccaagattagataac
ggcaagcctgattttagctattttgcgcccgactgctttcattttagtagcaaggggcac
atggaaggggcaattgcactgtggaagaatatgtttgaaccagttggcagcaagacctca
ggctgggatctacctggaaaactgtactgtccaacagaggataacaagtacttatttact
aagaagaatagtcctccaccttcattatttggtcagtcaggaactgagcagtctgctggt
gttactactgaaggtgataaagctacacactccgcttcaattgctgtcagtgcaagcatt
ggtgctgtgtctttgcttgttgttgtaataattgtaatagttattgcttttaaactacgc
aataaaagaagagcaagaggaattggagagcaaataccgttgtttagcaataactga

DBGET integrated database retrieval system