KEGG   Amphimedon queenslandica (sponge): 100633933Help
Entry
100633933         CDS       T02284                                 

Definition
enoyl-CoA hydratase, mitochondrial-like
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100633933
   01212 Fatty acid metabolism
    100633933
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100633933
   00650 Butanoate metabolism
    100633933
  Lipid metabolism
   00062 Fatty acid elongation
    100633933
   00071 Fatty acid degradation
    100633933
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100633933
   00310 Lysine degradation
    100633933
   00380 Tryptophan metabolism
    100633933
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100633933
Enzymes [BR:aqu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100633933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 290 aa AA seqDB search
MSLYRVGLSRGMLSSFQRVMRGEGLHTSSAVQYEYIKVDKRGEKKNVGLIQLNRLKALNA
LCDGLVSEIGEALQEMETDTSIDAIVITGSERAFAAGADIAEMKDKSFQDCYARKFLSHW
DIISKCPKPTIAAVNGFALGGGCEVAMMCDIIYAGEKAKFGQPEITLGTIPGAGGTQRLT
RAIGKSKAMEMILTGEFMSAQEAEKAGLVSKVFPVEELVGEAIKLGERIGEFSQIAAAMC
KEAVNMSDELPLSNGLLYEKKLFHSSFATDDKREGMTAFLEKRKPDFKDN
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgtacagggtaggtctatccagaggaatgttgagctcattccagcgagtgatg
agaggggaaggactccacacgagcagtgcagtacagtacgagtatattaaagtggacaag
agaggagaaaagaaaaatgttggcctgattcagttgaatcgtctcaaagcactgaatgcc
ctttgtgatgggctggtctctgaaataggagaagcacttcaagaaatggaaactgatacc
agcattgacgccattgtgatcactggtagtgaaagagcttttgctgctggagctgatatt
gctgagatgaaggataagtcttttcaggattgctatgctcgaaagttcctatctcattgg
gacatcatttcaaagtgtcccaaaccaacaatagcagctgtgaatggattcgctttagga
ggaggttgtgaggtggccatgatgtgtgatattatatatgcaggtgaaaaggcaaagttt
ggccagcctgagattacactgggtacaatacctggagcaggaggcacccaaagactaact
agggccattgggaaatcaaaagcaatggaaatgatactaacaggagaatttatgagtgca
caggaggcagagaaagcaggtcttgttagtaaagtgtttccggtagaggaactggtggga
gaggctatcaagttaggtgaacgtattggtgagttctcacagattgcagctgcaatgtgt
aaagaagccgttaacatgtctgacgaattaccactcagtaatggtttgttgtatgagaag
aaattgttccattcttcatttgctactgatgacaaaagagagggaatgactgccttcctt
gagaaacgtaaaccagactttaaagacaattaa

DBGET integrated database retrieval system