KEGG   Amphimedon queenslandica (sponge): 100634020Help
Entry
100634020         CDS       T02284                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type-like
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100634020
   01230 Biosynthesis of amino acids
    100634020
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100634020
   00030 Pentose phosphate pathway
    100634020
   00051 Fructose and mannose metabolism
    100634020
   00052 Galactose metabolism
    100634020
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100634020
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100634020
Protein phosphatases and associated proteins [BR:aqu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100634020
Messenger RNA biogenesis [BR:aqu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100634020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 846 aa AA seqDB search
MLRKIKMAASMEVASSPPLRTLSQPVETKDLMKKKDTEDRCLAVLTSGGDSQGMNAAVRA
VVRIALFKGMKPYLVNEGYKGLVEGGELIKECQWTDVTHTMHKGGTIIGTARCKEFRERS
GRLDAAANLVKARINNLVIIGGDGSLTGANIFKEEWKGLLEELVRKERITQEEAALLPYL
NIVGLVGSIDNDMCGTDMTIGTDSALHRIIEAMDCLVSTASSHQRTFVLEIMGRNCGYLT
IMAGIAVGAEWVLIPENPPKEGWEESMCDKLKSSREKGRRLNFILVAEGAIDQENKKITT
SDVKKVIDSKLGFDTRVTVLGHVQRGGRPSAYDRILGTRMGAAAVQTLFEAKGEMDAFMI
AIRGNEMTKLPLMSCVETTKKIGSALNERDFNRMQELRGSSFARNIKILKKLEACPTTTC
KPESSPSSPSYTFAVMNVGAPAGGTNSCTRSFVRFLLYSGHTVLGIYSGFDGLKEGEIKN
LDWSEVSEWGSVGGSKLGTTRTVPDDKSLDAIAKSLESHGIQGLLVVGGFEAFQSLIKLE
EGRRKYPALCIPIVQVAATISNNVPGTEYSLGCDTALNVIVSACDILKQSATASRKRVFV
VETMGGYCGYLATMGALAGGADSAYIFEESFNLDHLRKDVAHMVHKFKAGNFEKGIIMRN
ESCNNNYTTDFMTQMLAEEGKDYFIARSSVLGHLQQGDAPSPFDRILGTKYAYQSMNHLL
ECMERSTTSEGKVLATGSDTICVMGLVGVEYKPTPVSVLKDKCDMKYRIPNDQWWIQLRP
LVRILARHADKKFHGETDMIDDDTRSKEPHPPQFKGLSMNDVKPFLPPLLVLGAMIAMTF
ARLNNW
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgctcagaaaaataaagatggcagcttcaatggaagtcgcatcttctccgcctttgcgt
actctttctcagcccgtggagacgaaagatttgatgaagaagaaagatactgaagatcgc
tgcctggccgtccttaccagcggtggagattctcaaggaatgaatgcagcagtgagagct
gtcgtccgtattgctctgttcaaagggatgaagccttaccttgttaatgaaggctataaa
ggtctggttgaaggcggggaattgatcaaggagtgccagtggacggacgtcactcataca
atgcataaaggtgggacgataatagggacggcaagatgtaaagagtttcgcgagagatca
ggaagactggacgcagcagcaaaccttgtcaaagccagaatcaacaacctagtcatcatc
ggaggagacggtagcctcacaggagctaacatctttaaagaggaatggaaaggactcctg
gaggaactagttagaaaagagaggataacgcaagaggaagcagccttgcttccttacctc
aatatagttggactggtaggatccattgataatgatatgtgtggaactgatatgaccatc
ggtacagactcggcactccatcgtatcatagaagcaatggattgtcttgtgtccactgcc
tccagtcaccagaggacctttgtactggagataatgggacggaactgtgggtaccttacc
atcatggccggcatagccgtgggggctgaatgggtactgataccagaaaacccacccaag
gaaggctgggaggaaagcatgtgcgataaattaaagtcgtctcgagaaaaaggaaggcga
ctaaattttatcctagtcgctgagggggccattgatcaagaaaacaaaaaaatcacaacg
tctgatgtcaagaaagtaattgattcaaagctagggtttgatactagagtgactgtattg
ggtcacgtacaacgtgggggaagaccctctgcttacgaccgtatactgggcactaggatg
ggagcagctgctgtccagaccttgtttgaagcaaagggggagatggatgctttcatgatt
gctattagaggaaatgagatgaccaaactgcctctgatgtcttgtgtggaaacgacaaag
aagattggaagtgctctgaatgagcgagacttcaatcgaatgcaagagctaagaggatcc
agctttgctagaaacataaagatacttaagaagcttgaggcctgtccaacgaccacctgc
aaaccagagtcaagtcccagctctccttcttacacatttgccgtgatgaatgttggagca
cctgctggtggaaccaacagctgcaccaggtcctttgtacgcttcctattatacagtgga
cacactgtactgggaatatacagtggatttgatgggctaaaggagggagagattaagaac
ttggactggtctgaagttagtgagtgggggtcagttggtgggtctaaactgggtaccaca
cgcacggtccctgatgacaaatcacttgatgctatcgctaaatccttagagtctcatggt
atccaaggcctgctggtcgtcggtggatttgaagcgtttcaatctctgatcaagttggag
gagggtaggcgcaagtatccagcactatgcatccccatagtccaagtggcagctaccata
agcaacaatgtccctggcaccgagtatagtcttggttgtgatactgctctgaatgtcatt
gtctccgcttgtgacatactcaagcaatcggccactgctagcaggaagcgtgtctttgtc
gtggagactatggggggctattgtggctacctggcaacaatgggtgctctagcaggtgga
gctgacagtgcgtacatatttgaagagtcctttaatttagatcaccttcgcaaggatgtg
gctcacatggttcacaagtttaaagctggtaattttgagaaaggtatcatcatgcgtaac
gaatcctgcaataataactacacgactgatttcatgacgcagatgctagccgaagaaggc
aaggactactttatagccaggagcagtgtcttgggtcacctccagcaaggcgatgcaccg
agtccatttgatcgtatactaggcactaagtatgcctatcaatccatgaatcacctgttg
gaatgtatggagcgcagtaccactagtgaagggaaggtgttagccactgggagtgataca
atctgtgtcatgggtctagttggagtggagtataagcccacaccagtctctgttctaaag
gataagtgtgatatgaagtacaggatacctaatgatcaatggtggatacagctacgtcct
ctagtccgtatactagcgcgtcatgctgataaaaagtttcacggagaaactgatatgatt
gatgatgacactcgatcaaaggagcctcatcctcctcagttcaaaggattgtcaatgaat
gatgtgaagccattcttgcctccactactggtgttaggtgctatgattgctatgacattt
gctagacttaataactggtga

DBGET integrated database retrieval system