KEGG   Amphimedon queenslandica (sponge): 100634035Help
Entry
100634035         CDS       T02284                                 

Definition
ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100634035
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     100634035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 322 aa AA seqDB search
MAEVVVAGSCMIDLICYVSRLPKPGETIAGRSFSQGFGGKGANQCIMAARLGSSTAMVAK
LGNDSFGRSTIENFNTNKVNVDHVGIVDESQSGVAQITVNDEGENSIVIVSGANNHLNDE
DLGSAKEMISRAKVLVCQLEISPETTLNALKLAKEAREDSAATTTIFNAAPGLAGLKKEF
YKYSDILCVNETEAELLSGVSVTDRASGESAVLSLQNEGPGCVVLTMGSGGVLYTLPREE
RNGDDSVSVHHIPAEPVNVVDTTGAGDAFVGALAYYIARHSSLSFSEKIRRSSLIATHTV
TLPGTQTSFQTHTLPKELMFLE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtagttgttgctggttcttgtatgattgaccttatatgttatgtgtcaaga
cttcccaaaccaggggagactattgctgggcggagcttcagtcaaggttttggagggaag
ggagccaatcagtgcataatggcagcacgccttggctcatcaacagcaatggtggctaaa
ctagggaatgacagctttggtcggagcacgattgagaacttcaatacaaacaaagtcaac
gttgatcatgttggtatcgttgatgagagtcagtctggtgtcgctcaaataacagttaat
gatgaaggagaaaactccattgtaattgttagtggtgctaataatcacttaaatgatgag
gaccttggatctgcaaaggagatgatatcaagagctaaagtattagtgtgccaattggaa
atatcaccagagacgacacttaatgctctcaaacttgctaaagaggcaagagaagactct
gctgctaccacaactatatttaatgctgctcctggccttgctggactaaagaaagagttt
tataaatactctgacatactgtgtgtgaatgaaacagaggctgaattattatctggagta
tcagtaactgatagagcctcaggtgaaagtgctgttttatctttgcagaatgaaggacca
ggctgtgttgtattaaccatggggagtggaggagtcttatacacactacctagggaagaa
agaaatggagatgactcagttagtgtgcatcacatacctgcagagcctgttaatgttgtt
gatactacaggagcaggtgatgcatttgtaggagcactggcatattatatagcaagacac
tccagtcttagtttttcggagaagataagaaggtcctcactcattgccacacacactgtt
acactaccaggaacacagaccagcttccaaacacacaccctccctaaagaactcatgttc
ctggaatag

DBGET integrated database retrieval system