KEGG   Amphimedon queenslandica (sponge): 100634047Help
Entry
100634047         CDS       T02284                                 

Definition
(RefSeq) profilin-2-like
  KO
K05759  
profilin
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Membrane trafficking [BR:aqu04131]
 Others
  Actin-binding proteins
   Others
    100634047
Cytoskeleton proteins [BR:aqu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     100634047
Exosome [BR:aqu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100634047
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 135 aa AA seqDB search
MSISKKEKWQRYVDDALLKTEQVTMAAIHGLDGEAWATSDGFNVTTEQVAKLVTCITGDT
TTLKKSGIKVGNRSYILLRDDPGRSVYGRKGADSGVCVVKTKRALLIGVYGVGVQPGNCN
AVMEKMADYLIEHGL
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgtccatctcaaagaaagagaaatggcagcgatacgtggacgatgctctcctcaaaacc
gagcaggtgacaatggccgccatacacggcttggacggagaggcatgggccacatcagat
ggatttaatgtgaccacagagcaagtagcaaagcttgtaacttgcatcacgggagatacc
accacacttaagaaatctggcatcaaagtcgggaatcggagctacatactgttaagagat
gatcctgggagatcagtgtatggtcgcaaaggagctgactctggcgtctgtgttgtgaag
acgaaacgtgctttactgattggtgtgtatggagttggtgtccagcctggaaactgtaat
gctgtcatggaaaaaatggctgactatttgattgagcatggactgtag

DBGET integrated database retrieval system