KEGG   Amphimedon queenslandica (sponge): 100634159Help
Entry
100634159         CDS       T02284                                 

Definition
(RefSeq) protein unc-13 homolog A-like
  KO
K15293  
protein unc-13 A/B/C
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Membrane trafficking [BR:aqu04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    100634159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 1408 aa AA seqDB search
MSSLNLCLHVYSGVIDLLEETSLFVRASVNEVTKVTNKQSLAKPVWNEDIFFQVDHIVGD
LWVELYSSSFLRQQLLGHTMVPLYSIRHSNKKSDGQSYNLVLADDGDDDSPTNHSLVLDM
HFELPQNIPRKELEMLEKKLNSLRLTLQEEAKVISYQHVQLHKKKLPLPDKQPGKFEYPD
EVKKVVAVNPHLSKKNRKVSFLDEEDDDEIDGDTPPPVKLTAREKWQSVLSKPEFIRLRD
EGSIRRPNRGRGGSLADLVSHMQGLKKIETTVVSDDQVASFSQKVYKRLKTRQRSREALH
AVKETIDEDFRIHVYKKALQAMIYPASSLHAHQFVEKSYKSFTYCGECEGFIWGLAKQGV
QCEKCGKNSHKKCAASAKHDCFHIRDSQSSSVQESHLMVITEVMRKTVVSQSKKFDLLKE
AFSITDVENSNIIDEVTSTIKDLARKFTAIVDIKVIAAQGLAFNEQAEGKRLYVSIDVGG
EKKRTKAYKEVHHSPQWSEDFQFECQNYLEPIKIRVWNERHTTMSKLTHRMTSEGDHFLG
QKIIEVLRLGAANTLWYKLEKRTADNIVSGSIQLTLSSKIAGEFLIAPYHIMYSQLHEQL
FLHCHFRKQKDLVICSTDHKDKCDLLPGVAQDIIDEFAKRFAVEQIYRLLVHFKLILDHS
LLLANPYKAMNNILVHAREMMFHLSAEENAIRGVGLQTLMVELLDSSNFGRDKVAQLIQK
LTGQLLLNLQSYRDSYPVTSKEKLTELTNTCELLKTVCDFERKAVGIESASRVGNVSKAI
EGAMKECARTTFDDIVQELIPDDYEGHPALDKNASPFEFYYSLLKQIISAIVEDKTVYQP
YIKKYVDFELDAVSMIEFWNLFKETIQDLFKVDDNLNVFPPIEAIHLLLLVKKFYEERVR
KLEKNLERLEYPYWFEPAVKYWIQDFQQNALNFVNNSWEHDKAAHFQPDSNQNFSASAYD
MFVYFHKGQELIQGLDSDQLDLRHIYLFEYSKVIKSLILHYIDLASVEIPNAGSKLDITL
MLLNNFQFIRFGVQSIFEAMHGPENAGPQATEELQDLQTILTKQLNTWCPFVMNSQKESI
WNHMRHMQEELMKLKAQGSATRADAKVMVELVLDALFARAEKIGKVCEKDTLLPKLIKEL
WFVVMEGFQCLLLPNLTAITGEQVESVFHHVNYNQRQCALLDLIIDLFKEFFMDDHAGVK
ESTLSRNVKQMKAITKLFRQTTESLIGECLKSFKYDSQIDRDSYGELSLELNIGRRPASG
GMDGTLRVISGKDIKSLSHSSSGFKIFIDFNFIFPNCQQFSKYRYSTGATSAADINHTFK
FTLPPTEYCQLQATVKHKPLIGGDQILGVASVPFDVIMKSRVYTMNLNGALFHDERGRAF
LTVLALRHSDEIARDFVILKTYKRIEGD
NT seq 4227 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcctcaatctctgtctccacgtatattccggagtcatagatctccttgaagag
acgagtcttttcgttagagcaagtgtcaatgaagtaaccaaggtgactaacaagcagtct
ctcgcaaaaccggtctggaatgaagatattttctttcaagttgatcacattgttggtgat
ctgtgggtcgagctctactcctcgtccttcctgcgccagcagctccttggtcacacaatg
gtaccactctactccatcaggcactcaaacaaaaaatctgatggtcagtcttataatttg
gtgttagctgatgatggtgatgatgactctcccactaatcactctcttgttttggacatg
cattttgaactaccacagaatattccacgtaaggaattagagatgcttgaaaagaagtta
aattcgctgagactcacactacaagaagaggctaaagtcatatcatatcagcacgttcaa
ttgcacaagaaaaaactccctctcccagacaaacagccaggaaaatttgagtacccagac
gaagtaaagaaagtcgtagccgtcaaccctcatctcagcaagaagaaccgaaaagttagt
ttccttgatgaggaagacgatgatgaaatagacggcgatacaccacctcctgtaaaacta
acagcaagagaaaaatggcagtcggttctctctaaacctgaattcataagattgagagac
gagggatctatcagaaggcccaatcgtggaagaggagggtccctagcagatcttgtcagt
cacatgcaaggcctcaagaagatagagacgacagtagttagtgatgatcaagtagcttca
ttctcacagaaagtatataaaaggttgaagacgaggcaaaggagtagggaggcactgcac
gcagtcaaagaaacaattgatgaagattttaggatacatgtgtacaagaaggcattacag
gctatgatatatcctgcctcaagtctacatgctcatcagtttgtagagaagtcttacaag
tccttcacgtattgtggagagtgcgagggcttcatttggggattagccaaacaaggagtc
cagtgtgaaaaatgtggtaaaaattctcacaagaaatgtgccgcgtctgcaaagcacgat
tgttttcacataagggactctcagtcttcgtcagtgcaagagtctcatctgatggtcatt
actgaagttatgaggaaaactgttgtcagtcaaagcaaaaagtttgatcttttaaaggaa
gcattcagcatcactgatgtggagaactctaatatcattgatgaggtgacttctaccatc
aaagatctagctaggaagttcactgctattgtggacattaaagtcattgcagctcaaggt
cttgccttcaacgagcaggccgaaggcaagaggttgtatgtgtctattgatgttggagga
gaaaagaaaagaactaaagcttacaaagaagtacaccattcccctcaatggagtgaagac
ttccaatttgagtgccagaattacttggaaccgatcaagattagagtgtggaacgagaga
cacactacaatgagtaaactaactcacaggatgacatccgaaggcgatcactttttggga
cagaagatcattgaagtgttaagactaggtgcagcaaacacactctggtacaaactagag
aagagaacggcagataacattgtttctggctcaatccagttaacactatcctcaaagata
gctggtgaatttctcatagcaccatatcacataatgtactcacagctacacgagcaactg
tttcttcactgtcatttcagaaagcagaaagatctagtaatatgcagtacagatcataaa
gataagtgtgatctattgcctggtgttgctcaagatatcattgatgagtttgctaaaaga
ttcgccgtagaacagatataccgactattagtacatttcaaattaattcttgatcattcc
ctattacttgctaacccgtacaaagctatgaacaatatactagtacatgccagagaaatg
atgtttcacctgagtgcagaggagaacgccattagaggagttggactccagacattaatg
gtggagctactggactctagcaactttggacgtgacaaagttgcacagctcattcaaaag
ctaactggacagctgctactgaatctacagagctacagagactcttaccctgtcactagc
aaagagaagctaaccgaattgacaaacacatgtgaattgctcaaaactgtttgtgatttt
gaaagaaaggctgttggtatagaaagtgcttcaagggtaggaaatgtctccaaagctatt
gaaggagcaatgaaggagtgtgctaggacaacttttgatgacattgtacaagagctgatc
cctgatgactatgagggacacccagcacttgacaagaatgcatcaccttttgaattttat
tacagcttgctaaaacaaatcatatctgccattgtggaggacaagacagtctatcagcca
tacattaaaaagtatgttgattttgaattggatgcagtttcaatgatagagttttggaat
cttttcaaagaaacaattcaggatttgtttaaagttgatgataatttaaacgtattccca
cctattgaagctattcacttacttttactggtgaagaaattctacgaagagagagttaga
aagctagagaaaaaccttgagagacttgagtacccgtattggtttgagccggcagtcaag
tactggatacaggactttcaacaaaatgctctcaatttcgtcaacaacagttgggagcac
gataaagcagctcactttcaacctgatagcaatcaaaacttttcagcttctgcttacgac
atgtttgtgtactttcacaaggggcaagagctcattcaaggacttgactctgatcagttg
gacctcagacacatttatctctttgaatattcaaaagttattaaaagtcttattctacat
tacattgatcttgcttcagttgagataccaaatgctggctctaaactagacattacactg
atgttgctcaataactttcagttcattcgtttcggagttcaaagcatattcgaagcaatg
catggacctgagaatgctggcccccaggccactgaggagctccaagacttacagacgata
ctaactaaacaattaaacacttggtgtcccttcgtaatgaacagtcagaaggaatccata
tggaatcatatgagacacatgcaagaggaattaatgaaattaaaggcacagggttctgct
actagagctgatgcaaaagtgatggttgagcttgtactagatgcactgtttgcaagggct
gaaaagattggaaaggtttgtgagaaagacacgcttttaccgaaattaataaaagagcta
tggtttgtagtaatggaaggattccagtgtctgctactgccgaacctaacagctatcact
ggggaacaagttgagagtgtcttccaccatgtcaattataatcaaagacagtgtgcatta
ttagacctcatcattgatcttttcaaggagttttttatggatgatcatgctggagtgaag
gagtctacactgagtcgtaacgtaaagcaaatgaaagcaatcacgaaactgttccgtcaa
acgactgaatcactgataggagaatgtctgaaatcatttaaatacgatagtcaaattgac
agagattcttatggagagttgtcccttgaactgaatattggtaggagaccagcttctggt
ggaatggatggtacactaagagtaatatctgggaaagatattaaatcactcagccattct
tctagtggtttcaagatattcattgattttaattttatatttccaaactgtcagcaattc
tcaaagtacagatacagcactggagcgacctcagcagctgacattaaccacacattcaaa
tttacacttcctccaactgaatattgccagttgcaagcaacagtgaaacacaagcctctc
ataggcggtgatcagatattgggtgtggcctcggtaccttttgacgtcataatgaagagc
agagtatacactatgaatctcaatggagcattgtttcatgatgagcgtgggcgggccttt
ctcacggtactagccttgagacatagcgacgaaatagcgagagactttgtcattttgaaa
acttacaagcgaatcgagggagactga

DBGET integrated database retrieval system