KEGG   Amphimedon queenslandica (sponge): 100634159Help
Entry
100634159         CDS       T02284                                 

Definition
(RefSeq) protein unc-13 homolog B-like
  KO
K15293  
protein unc-13
Organism
aqu  Amphimedon queenslandica (sponge)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1163 aa AA seqDB search
MADRQNNNEECEEDEKEDKFRKRRNAIWKRQRVSHMQGLKKIETTVVSDDQVASFSQKVY
KRLKTRQRSREALHAVKETIDEDFRIHVYKKALQAMIYPASSLHAHQFVEKSYKSFTYCG
ECEGFIWGLAKQGVQCEKCGKNSHKKCAASAKHDCFHIRDSQSSSVQESHLMVITEVMRK
TVVSQSKKFDLLKEAFSITDVENSNIIDEVTSTIKDLARKFTAIVDIKVIAAQGLAFNEQ
AEGKRLYVSIDVGGEKKRTKAYKEVHHSPQWSEDFQFECQNYLEPIKIRVWNERHTTMSK
LTHRMTSEGDHFLGQKIIEVLRLGAANTLWYKLEKRTADNIVSGSIQLTLSSKIAGEFLI
APYHIMYSQLHEDHKDKCDLLPGVAQDIIDEFAKRFAVEQIYRLLVHFKLILDHSLLLAN
PYKAMNNILVHAREMMFHLSAEENAIRGVGLQTLMVELLDSSNFGRDKVAQLIQKLTGQL
LLNLQSYRDSYPVTSKEKLTELTNTCELLKTVCDFERKAVGIESASRVGNVSKAIEGAMK
ECARTTFDDIVQELIPDDYEGHPALDKNASPFEFYYSLLKQIISAIVEDKTVYQPYIKKY
VDFELDAVSMIEFWNLFKETIQDLFKVDDNLNVFPPIEAIHLLLLVKKFYEERVRKLEKN
LERLEYPYWFEPAVKYWIQDFQQNALNFVNNSWEHDKAAHFQPDSNQNFSASAYDMFVYF
HKGQELIQGLDSDQLDLRHIYLFEYSKVIKSLILHYIDLASVEIPNAGSKLDITLMLLNN
FQFIRFGVQSIFEAMHGPENAGPQATEELQDLQTILTKQLNTWCPFVMNSQKESIWNHMR
HMQEELMKLKAQGSATRADAKVMVELVLDALFARAEKIGKVCEKDTLLPKLIKELWFVVM
EGFQCLLLPNLTAITGEQVESVFHHVNYNQRQCALLDLIIDLFKEFFMDDHAGVKESTLS
RNVKQMKAITKLFRQTTESLIGECLKSFKYDSQIDRDSYGELSLELNIGRRPASGGMDGT
LRVISGKDIKSLSHSSSGFKIFIDFNFIFPNCQQFSKYRYSTGATSAADINHTFKFTLPP
TEYCQLQATVKHKPLIGGDQILGVASVPFDVIMKSRVYTMNLNGALFHDERGRAFLTVLA
LRHSDEIARDFVILKTYKRIEGD
NT seq 3492 nt NT seq  +upstreamnt  +downstreamnt
atggctgatagacaaaataacaatgaggagtgcgaggaagatgagaaggaggataagttt
aggaaaaggaggaatgcaatttggaagagacagcgtgtcagtcacatgcaaggcctcaag
aagatagagacgacagtagttagtgatgatcaagtagcttcattctcacagaaagtatat
aaaaggttgaagacgaggcaaaggagtagggaggcactgcacgcagtcaaagaaacaatt
gatgaagattttaggatacatgtgtacaagaaggcattacaggctatgatatatcctgcc
tcaagtctacatgctcatcagtttgtagagaagtcttacaagtccttcacgtattgtgga
gagtgcgagggcttcatttggggattagccaaacaaggagtccagtgtgaaaaatgtggt
aaaaattctcacaagaaatgtgccgcgtctgcaaagcacgattgttttcacataagggac
tctcagtcttcgtcagtgcaagagtctcatctgatggtcattactgaagttatgaggaaa
actgttgtcagtcaaagcaaaaagtttgatcttttaaaggaagcattcagcatcactgat
gtggagaactctaatatcattgatgaggtgacttctaccatcaaagatctagctaggaag
ttcactgctattgtggacattaaagtcattgcagctcaaggtcttgccttcaacgagcag
gccgaaggcaagaggttgtatgtgtctattgatgttggaggagaaaagaaaagaactaaa
gcttacaaagaagtacaccattcccctcaatggagtgaagacttccaatttgagtgccag
aattacttggaaccgatcaagattagagtgtggaacgagagacacactacaatgagtaaa
ctaactcacaggatgacatccgaaggcgatcactttttgggacagaagatcattgaagtg
ttaagactaggtgcagcaaacacactctggtacaaactagagaagagaacggcagataac
attgtttctggctcaatccagttaacactatcctcaaagatagctggtgaatttctcata
gcaccatatcacataatgtactcacagctacacgaggatcataaagataagtgtgatcta
ttgcctggtgttgctcaagatatcattgatgagtttgctaaaagattcgccgtagaacag
atataccgactattagtacatttcaaattaattcttgatcattccctattacttgctaac
ccgtacaaagctatgaacaatatactagtacatgccagagaaatgatgtttcacctgagt
gcagaggagaacgccattagaggagttggactccagacattaatggtggagctactggac
tctagcaactttggacgtgacaaagttgcacagctcattcaaaagctaactggacagctg
ctactgaatctacagagctacagagactcttaccctgtcactagcaaagagaagctaacc
gaattgacaaacacatgtgaattgctcaaaactgtttgtgattttgaaagaaaggctgtt
ggtatagaaagtgcttcaagggtaggaaatgtctccaaagctattgaaggagcaatgaag
gagtgtgctaggacaacttttgatgacattgtacaagagctgatccctgatgactatgag
ggacacccagcacttgacaagaatgcatcaccttttgaattttattacagcttgctaaaa
caaatcatatctgccattgtggaggacaagacagtctatcagccatacattaaaaagtat
gttgattttgaattggatgcagtttcaatgatagagttttggaatcttttcaaagaaaca
attcaggatttgtttaaagttgatgataatttaaacgtattcccacctattgaagctatt
cacttacttttactggtgaagaaattctacgaagagagagttagaaagctagagaaaaac
cttgagagacttgagtacccgtattggtttgagccggcagtcaagtactggatacaggac
tttcaacaaaatgctctcaatttcgtcaacaacagttgggagcacgataaagcagctcac
tttcaacctgatagcaatcaaaacttttcagcttctgcttacgacatgtttgtgtacttt
cacaaggggcaagagctcattcaaggacttgactctgatcagttggacctcagacacatt
tatctctttgaatattcaaaagttattaaaagtcttattctacattacattgatcttgct
tcagttgagataccaaatgctggctctaaactagacattacactgatgttgctcaataac
tttcagttcattcgtttcggagttcaaagcatattcgaagcaatgcatggacctgagaat
gctggcccccaggccactgaggagctccaagacttacagacgatactaactaaacaatta
aacacttggtgtcccttcgtaatgaacagtcagaaggaatccatatggaatcatatgaga
cacatgcaagaggaattaatgaaattaaaggcacagggttctgctactagagctgatgca
aaagtgatggttgagcttgtactagatgcactgtttgcaagggctgaaaagattggaaag
gtttgtgagaaagacacgcttttaccgaaattaataaaagagctatggtttgtagtaatg
gaaggattccagtgtctgctactgccgaacctaacagctatcactggggaacaagttgag
agtgtcttccaccatgtcaattataatcaaagacagtgtgcattattagacctcatcatt
gatcttttcaaggagttttttatggatgatcatgctggagtgaaggagtctacactgagt
cgtaacgtaaagcaaatgaaagcaatcacgaaactgttccgtcaaacgactgaatcactg
ataggagaatgtctgaaatcatttaaatacgatagtcaaattgacagagattcttatgga
gagttgtcccttgaactgaatattggtaggagaccagcttctggtggaatggatggtaca
ctaagagtaatatctgggaaagatattaaatcactcagccattcttctagtggtttcaag
atattcattgattttaattttatatttccaaactgtcagcaattctcaaagtacagatac
agcactggagcgacctcagcagctgacattaaccacacattcaaatttacacttcctcca
actgaatattgccagttgcaagcaacagtgaaacacaagcctctcataggcggtgatcag
atattgggtgtggcctcggtaccttttgacgtcataatgaagagcagagtatacactatg
aatctcaatggagcattgtttcatgatgagcgtgggcgggcctttctcacggtactagcc
ttgagacatagcgacgaaatagcgagagactttgtcattttgaaaacttacaagcgaatc
gagggagactga

DBGET integrated database retrieval system