KEGG   Amphimedon queenslandica (sponge): 100634262Help
Entry
100634262         CDS       T02284                                 

Definition
NADPH--cytochrome P450 reductase-like
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     100634262
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 514 aa AA seqDB search
MASSHDGESSYFSYLDVFLLGVFILVLFLIVRKFRRRARGDDERVKKLQINPVIKQISSP
VYSSSLSTSGSFIDKMKTRKKRVLILYGSQTGTGEEFSNRLAKDSSRLGLPAMTFDPEDC
TDWDDLTRVGQEVEGSLVIFVMATYGEGDPTDNAQEFFDWLKETTDNLQGLKYTVFGLGN
KTYEHYNEMGRYVDQRLEELGGERIYVRGEGDDDGNIEEDFITWKEGLWPEVMQYFKIDS
SQATAVGREYEFSLHTEISTDEVFTGEPNRLGSYKNQKVPYNSKNPFLAPVTVIRELHKG
GDRSCMHIELDITGSKLSYVAGDHVAIFPMNDPQQVERIGELLGIDLDSVFSLTNVDPEA
TKPHPFPCPTSYRTALSHYVDIAAPPRTHVLFKVAQKSSPRPYKKLGATLLFFGCRNCAH
DYLYQEELEEYESKGILSGLYVAFSREQKGKEVWELIEGQGFFYVCGDARNMARDVQNTL
LSIIKEHGGKTETEATEYIKKLQKRGRYLQDVWS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcatctcatgatggagagtcttcatatttcagttacttggatgtctttttatta
ggagtcttcattctcgtccttttcctgatagttagaaagtttaggaggagagcaagagga
gatgatgagagggttaaaaagctgcaaattaatccagttataaaacagatttcttctcct
gtttattcctcctcactgagtacgtctggtagttttattgataaaatgaaaacccgaaag
aaaagagtattgattctgtatgggtctcaaactggcactggggaagagttctctaataga
ttagcaaaggactcatctcgtttaggactaccagccatgacctttgaccctgaggactgc
actgactgggatgaccttactagagtaggacaggaagttgaaggatcacttgttattttt
gtaatggccacttatggagagggagacccaactgataatgctcaggaattttttgactgg
ttaaaagaaactactgataatcttcaaggactaaaatatacagtctttggattgggtaat
aaaacatatgaacattataatgagatgggacgctacgttgatcagagattagaagaatta
ggaggagagagaatatatgtgagaggagaaggagatgatgatggaaacattgaagaggat
ttcattacatggaaggaaggtttgtggcctgaggtgatgcagtatttcaaaatagattca
agtcaagcaacagctgttggtagagagtatgagttcagtcttcatactgagatatcaact
gatgaagtatttactggagaaccaaacagactaggatcatataagaaccagaaagtccct
tacaacagtaagaacccattcctggctccagtcacagttataagagagctacataaagga
ggtgatcgctcttgtatgcacatagaactggacatcactggtagcaagctctcttatgta
gcaggagatcatgttgccatattcccaatgaatgatccacaacaagttgagaggattggg
gaattattaggaatagatcttgactctgttttcagtctcactaatgttgacccagaagct
actaaaccacatccattcccttgccccactagttataggactgctctctctcattatgtt
gatattgctgctcctcctcgtacacacgtcctttttaaagttgctcaaaaatctagcccg
agaccatataagaaacttggagctacattacttttctttggttgtcgtaattgtgctcat
gattacttgtatcaggaggagctggaggagtatgagagtaagggaatactctctggactc
tatgtggccttctcacgagaacaaaaagggaaagaagtttgggaacttattgagggtcaa
ggtttcttttatgtgtgtggtgatgctcgtaatatggcacgtgatgtacagaacacactg
ttgtcaataataaaggaacacggaggaaagacagagacagaggctactgaatacattaag
aagcttcagaagagagggcgctaccttcaggatgtgtggtcatga

DBGET integrated database retrieval system