KEGG   Amphimedon queenslandica (sponge): 100634313Help
Entry
100634313         CDS       T02284                                 

Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase-like
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:aqu00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 179 aa AA seqDB search
MSGAWYMDEDYETDQREPHRSPNEPADVDMSLLADIGVLHWKLDTANYEGEGGTFDKLRK
ERGYNYSDIITVSPDKLPNYEQKIKSFFEEHLHSDEEIRFILEGSGYFDVRSKGDKWIRI
KVECGDLIILPAGIYHRFTLDNKNYIKAMRLFQGEPVWTPINRPADSHPARMTYLQSLQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgtctggagcctggtatatggacgaggattatgaaacagatcaaagagagccccatcgc
tcacctaacgagccagcagatgtagatatgtccttactggctgatattggagtccttcat
tggaagcttgatactgcaaactatgaaggagagggagggacttttgataagctgaggaaa
gagaggggttacaattatagtgacatcataacagtgtctcctgacaagctaccaaactat
gaacaaaagattaaatcattctttgaggagcacctacacagcgatgaagagattcgcttt
atcctagaagggagtggctattttgacgtgagaagtaaaggagacaagtggataaggatc
aaagttgaatgcggcgatcttataatccttccagctggaatataccaccggttcacactg
gataataaaaattatataaaggcaatgcgcctgtttcaaggtgagccagtgtggactcca
attaacagaccagctgacagccacccagcaagaatgacctatctccaatctttacaataa

DBGET integrated database retrieval system