KEGG   Amphimedon queenslandica (sponge): 100634383Help
Entry
100634383         CDS       T02284                                 

Definition
protein disulfide-isomerase A5-like
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100634383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 512 aa AA seqDB search
MKSYLILLLILFIKSSAPAAPESGIVRLEEPKAWKKFIKTRTNVLVLFASSGEVSVPRGL
LPILEEIAQEVKGLGAVAYVDCSSAKKLCKNLKIGGKGEQKKYYLKHFKDGSYHKDYDRL
LRKSSLLDFMKDPTSDAPWSEDPTSKDVRHIESSTGLYKFLAKEKKPILLMFYAPWCGHC
QLLKPEFAAAATSLKGKQVLAGMNLDKPETMLTREEYNVTGFPTLLYFEEGKVKYPYSGG
RDTDSIIKWLSDPQPPPSTQEVEQEAGANWSTELNNVVHLTSENFQSVIDSSPSTLVTFY
APWCGHCKAMKPDYNEAAKLLESENILGTLAAVDATAERELASHYQVSGFPTIKYFSNGK
ELYDYGYPRTTESFVEFMKNPQPPPEKEKDWSEIETGVHHLTDETYKPFIKKTKHALVMF
YAPWCGHCKAAKPEFIDAAASLKEDKKTSLAAVDCTKYAQICDQNDVQGYPTILYMSYGK
KSFKYMGPRDSNGFVEFLRNPNKYVSIVKDEF
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagctatttaattcttctacttattcttttcataaagagttccgctcctgcagca
ccagagagcgggatagtccggctagaagaaccgaaggcgtggaagaagttcataaagaca
cgtacaaatgttctcgtgttgtttgcatcttctggcgaggtgtcagtaccccgtggcctc
cttcccatacttgaagaaatagctcaagaagtgaaaggactcggtgcagttgcatacgtg
gactgtagctcagcaaagaaactctgcaagaatcttaagataggaggcaagggagagcaa
aagaaatactatctgaaacattttaaagatggctcatatcacaaggactacgatcgtctc
cttcgtaaatcctctctacttgatttcatgaaagacccaaccagcgacgccccatggtcc
gaggaccccacttctaaagacgtacgtcacattgagagcagtacaggcctctacaagttt
ctcgctaaagagaagaaaccgatacttcttatgttttatgctccctggtgcgggcactgt
cagcttttgaaaccagagtttgctgctgctgcaacgagccttaaagggaagcaagtccta
gccggaatgaatcttgataaaccagaaaccatgctgacacgagaggagtataatgtcact
ggattcccaactctcctttattttgaagaggggaaagttaaatacccatactctggtggg
agggacactgattctatcatcaaatggctctctgatcctcagcctcctcccagtactcag
gaggtagagcaagaggccggagcaaactggtccaccgaattaaacaacgtcgttcacctt
accagtgagaatttccaatcagtcattgactctagcccctcaacactggtgacgttttat
gctccgtggtgtggccactgtaaagcaatgaagccggactacaatgaagctgctaagttg
ttagaaagtgaaaatatcctcggaacactagcagccgtagatgcaacagcagaaagagag
ctggcgtcacactatcaagtgagtggattcccaactataaaatacttttcaaacggtaag
gaactatatgactacggctacccaaggacaacagagtcttttgtggagttcatgaaaaac
ccacaaccaccgcctgagaaggagaaagactggtcggagatagagactggcgtccatcat
ttaactgatgagacatacaagccattcatcaagaaaaccaaacacgctctggtaatgttt
tatgcaccgtggtgtggtcattgtaaggctgctaaaccagagttcattgatgctgcggcc
agtttaaaggaggacaaaaagacttcacttgctgcagtcgattgcactaaatatgctcaa
atttgtgatcaaaatgatgttcaaggatatcccactatactgtacatgtcttatggtaag
aagtcattcaaatacatggggcccagagatagcaatgggtttgtcgagttcctcaggaac
cctaacaaatatgtatctatagtcaaagatgagttttaa

DBGET integrated database retrieval system