KEGG   Amphimedon queenslandica (sponge): 100634474Help
Entry
100634474         CDS       T02284                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial-like
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00010  Glycolysis / Gluconeogenesis
aqu00020  Citrate cycle (TCA cycle)
aqu00620  Pyruvate metabolism
aqu01100  Metabolic pathways
aqu01200  Carbon metabolism
Module
aqu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100634474
   00020 Citrate cycle (TCA cycle)
    100634474
   00620 Pyruvate metabolism
    100634474
Enzymes [BR:aqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     100634474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 100634474
NCBI-ProteinID: XP_003384835
UniProt: A0A1X7VBR7
Position
Unknown
AA seq 620 aa AA seqDB search
MMLSRLGRTSWSCSRSWLRPSSSSTRRGVLGTSRRSLGTLRRANIARNSQRITSTLTYKT
TLNSSVFVRSLSSNLPSHTEVVLPALSPTMDQGTIVKWEKEVGDKLEEGDIIAQVETDKA
TMDMETPGEGYLARIIVPAGSKDLPLGKLLAIIVEEESDIEAFKDYAPSESQTTPTPTTP
APAASEPVSEGGAGGVPLDLPSHTEVVLPALSPTMDQGTIVKWEKEEGEKLEEGDIIAQV
ETDKATMDMETPGEGYLAKIIVPAGSKDLPLGKLLAIIVEDESDVAAFKDYSPSQTSSPA
PPMQAPPTATPTQTTSPIQSPPSGVKPPPPSASSPVGRIIASPYAKKLASEKSINLQSVS
GTGPGGRIVARDVLQGTPTVVPASVTTPTPGASYEDIQLSGMRKTIATRLMESKRNIPHY
YLSIDITMDDLLRLRSGVNSSGDIKLSVTDFLVKASGLALMEVPQVNSSWMESYIRQYNS
ADVSVAVSTEGGLITPIITGAENKGLKTISTEMRDLSERARSGRLQPHEFQGGTFTISNL
GMYGIRNFSAVINPPQSCILAVGATQKRVIVDEDDNKNYKVASVMSVTMSCDHRVVDGAV
GAQWLSVFKSYIEKPFKMLL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgatgctctccagattaggaaggacttcttggagttgcagcaggtcatggctccgtcct
tcatcctcctccacgaggagaggggtccttggaacgagtaggaggagcctagggacttta
agaagagccaatatagccagaaatagccaaagaataacatcaaccctgacttataaaact
accctgaactcctctgtgtttgtacgctctctctcgtctaaccttccatcccacactgaa
gtggttttaccagctctttctcccacaatggaccaagggaccattgtaaagtgggagaaa
gaagtaggtgataagttagaagagggagacatcatagctcaagttgagactgataaggct
acaatggatatggagacacctggtgaaggatatctcgctagaataatagtaccagctgga
agcaaagacctgccactggggaagttgcttgctattattgtggaggaagagagcgacatt
gaagcttttaaagattatgctccaagcgaatcacaaaccacgcctactccaacaacacca
gccccagcagcaagtgagccagttagcgaaggaggggctggaggcgttcctctagatctt
ccatcccacactgaagtagtattaccagctctctctcccacaatggatcaaggaactatt
gtaaagtgggagaaagaagaaggagagaagttagaagagggagacatcatagctcaagtt
gagactgataaggctacaatggatatggagacgcctggtgaaggatatctcgctaaaatt
atagtaccagctggaagcaaagacctgccactggggaagttactagcaattattgttgaa
gatgaatctgatgttgctgcctttaaagattattctccttctcaaacgtcatccccagct
ccacccatgcaagctccacctactgccacgcccacacaaactactagtcccatccaatcg
cctccatcaggtgtaaaacctcctcctccttcagcctcctctcctgttggtaggatcatt
gctagcccttacgccaagaaactagcttcagaaaaaagcataaaccttcagtctgtatcc
ggtactggtcctggtggtcgtattgttgcaagggatgttcttcaaggtacaccaactgta
gttcctgcatcagtgaccacgcccactcctggagcctcctatgaagacatacagttgtct
ggaatgcgcaaaacgatagctacaagactaatggagtcgaaaaggaacatacctcactat
tacctaagcattgatatcactatggacgacctattgaggttaagatcaggagttaattcc
agtggagatatcaaactatcagtgactgatttcttagtcaaggcctcgggactggctctg
atggaagtacctcaagtcaactcctcctggatggagtcctacatcagacagtacaacagc
gctgatgtgagtgttgctgttagtacagagggaggactaatcacaccaataatcactgga
gcagagaataaaggtttaaaaaccatcagtactgaaatgagggacctatcggagagggcc
aggagcggtcggctacagcctcatgagttccaaggaggtaccttcaccatatctaacctt
gggatgtacgggatacgtaacttctcagctgtcatcaatccaccacagtcttgtattctt
gctgttggagcaacacagaaaagagtcatagttgacgaagacgacaataaaaattacaag
gttgcctcggtgatgagtgtgacgatgagttgcgaccatagagtggtggatggagcagtt
ggggctcaatggctctcagtcttcaagtcttacattgagaaacctttcaagatgctgtta
tag

DBGET integrated database retrieval system