KEGG   Amphimedon queenslandica (sponge): 100634474Help
Entry
100634474         CDS       T02284                                 

Definition
dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial-like
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100634474
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100634474
   00020 Citrate cycle (TCA cycle)
    100634474
   00620 Pyruvate metabolism
    100634474
Enzymes [BR:aqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     100634474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 620 aa AA seqDB search
MMLSRLGRTSWSCSRSWLRPSSSSTRRGVLGTSRRSLGTLRRANIARNSQRITSTLTYKT
TLNSSVFVRSLSSNLPSHTEVVLPALSPTMDQGTIVKWEKEVGDKLEEGDIIAQVETDKA
TMDMETPGEGYLARIIVPAGSKDLPLGKLLAIIVEEESDIEAFKDYAPSESQTTPTPTTP
APAASEPVSEGGAGGVPLDLPSHTEVVLPALSPTMDQGTIVKWEKEEGEKLEEGDIIAQV
ETDKATMDMETPGEGYLAKIIVPAGSKDLPLGKLLAIIVEDESDVAAFKDYSPSQTSSPA
PPMQAPPTATPTQTTSPIQSPPSGVKPPPPSASSPVGRIIASPYAKKLASEKSINLQSVS
GTGPGGRIVARDVLQGTPTVVPASVTTPTPGASYEDIQLSGMRKTIATRLMESKRNIPHY
YLSIDITMDDLLRLRSGVNSSGDIKLSVTDFLVKASGLALMEVPQVNSSWMESYIRQYNS
ADVSVAVSTEGGLITPIITGAENKGLKTISTEMRDLSERARSGRLQPHEFQGGTFTISNL
GMYGIRNFSAVINPPQSCILAVGATQKRVIVDEDDNKNYKVASVMSVTMSCDHRVVDGAV
GAQWLSVFKSYIEKPFKMLL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgatgctctccagattaggaaggacttcttggagttgcagcaggtcatggctccgtcct
tcatcctcctccacgaggagaggggtccttggaacgagtaggaggagcctagggacttta
agaagagccaatatagccagaaatagccaaagaataacatcaaccctgacttataaaact
accctgaactcctctgtgtttgtacgctctctctcgtctaaccttccatcccacactgaa
gtggttttaccagctctttctcccacaatggaccaagggaccattgtaaagtgggagaaa
gaagtaggtgataagttagaagagggagacatcatagctcaagttgagactgataaggct
acaatggatatggagacacctggtgaaggatatctcgctagaataatagtaccagctgga
agcaaagacctgccactggggaagttgcttgctattattgtggaggaagagagcgacatt
gaagcttttaaagattatgctccaagcgaatcacaaaccacgcctactccaacaacacca
gccccagcagcaagtgagccagttagcgaaggaggggctggaggcgttcctctagatctt
ccatcccacactgaagtagtattaccagctctctctcccacaatggatcaaggaactatt
gtaaagtgggagaaagaagaaggagagaagttagaagagggagacatcatagctcaagtt
gagactgataaggctacaatggatatggagacgcctggtgaaggatatctcgctaaaatt
atagtaccagctggaagcaaagacctgccactggggaagttactagcaattattgttgaa
gatgaatctgatgttgctgcctttaaagattattctccttctcaaacgtcatccccagct
ccacccatgcaagctccacctactgccacgcccacacaaactactagtcccatccaatcg
cctccatcaggtgtaaaacctcctcctccttcagcctcctctcctgttggtaggatcatt
gctagcccttacgccaagaaactagcttcagaaaaaagcataaaccttcagtctgtatcc
ggtactggtcctggtggtcgtattgttgcaagggatgttcttcaaggtacaccaactgta
gttcctgcatcagtgaccacgcccactcctggagcctcctatgaagacatacagttgtct
ggaatgcgcaaaacgatagctacaagactaatggagtcgaaaaggaacatacctcactat
tacctaagcattgatatcactatggacgacctattgaggttaagatcaggagttaattcc
agtggagatatcaaactatcagtgactgatttcttagtcaaggcctcgggactggctctg
atggaagtacctcaagtcaactcctcctggatggagtcctacatcagacagtacaacagc
gctgatgtgagtgttgctgttagtacagagggaggactaatcacaccaataatcactgga
gcagagaataaaggtttaaaaaccatcagtactgaaatgagggacctatcggagagggcc
aggagcggtcggctacagcctcatgagttccaaggaggtaccttcaccatatctaacctt
gggatgtacgggatacgtaacttctcagctgtcatcaatccaccacagtcttgtattctt
gctgttggagcaacacagaaaagagtcatagttgacgaagacgacaataaaaattacaag
gttgcctcggtgatgagtgtgacgatgagttgcgaccatagagtggtggatggagcagtt
ggggctcaatggctctcagtcttcaagtcttacattgagaaacctttcaagatgctgtta
tag

DBGET integrated database retrieval system