KEGG   Amphimedon queenslandica (sponge): 100634744Help
Entry
100634744         CDS       T02284                                 

Definition
(RefSeq) replication protein A 32 kDa subunit-B-like isoform X1
  KO
K10739  
replication factor A2
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100634744
   03420 Nucleotide excision repair
    100634744
   03430 Mismatch repair
    100634744
   03440 Homologous recombination
    100634744
   03460 Fanconi anemia pathway
    100634744
DNA replication proteins [BR:aqu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    100634744
DNA repair and recombination proteins [BR:aqu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     100634744
   MMR (mismatch exicision repair)
     100634744
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     100634744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 341 aa AA seqDB search
MRKRRRDTYTGTFNISKMNFGGGYQSVGSSYGGGRGYQGGGSYDTFGGGGYMANEMGGGF
TSPGGTTGTPGGKDSKRGGFKNQATRPVTAAMLHRVTSPPGAEEIYLIDDEQVNQIVLVG
EIVEVFESATSVMYKIDDRTGPPVEVRRWINAEEDSQFELERRAACREGIYVKIVGHIKM
FNNQRTITGFMIRPIEDFNEVTHHMAETMFAHLAITKGLKLPEQFSDHQQGNQMGGASSF
GSTTPQAGGSGWTPLATSTQMSGTSYGNQFNSGLTLVQQKVLSVIGNTKGDHGLHVNDII
SSVKTQGFSDASIKTALDFLSNEGHVYSTIDEQHFKSTEDV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaaggaggcgggacacttacactggaacattcaacataagtaaaatgaatttt
ggaggtgggtaccagtctgtagggagctcttatggtgggggcagaggctaccaaggtgga
ggtagctatgatacttttgggggtggagggtacatggcaaatgaaatgggtggaggtttt
acctccccaggtgggacgacaggaacaccaggtggaaaagactcaaagagaggtggtttc
aagaaccaggcgacaaggccagtaacagctgcaatgcttcatcgagttacctcaccacct
ggggcagaggaaatttacttaattgatgatgaacaagtaaatcagatagttctggtcggt
gagattgttgaagtatttgaatcagctacaagtgtaatgtataagattgatgatagaaca
ggtccacccgttgaagtaagacgatggattaacgctgaagaggattcacaatttgaatta
gaaaggcgggcagcttgcagggaaggaatttatgtgaagattgttggtcacattaaaatg
tttaacaaccagagaacgatcacgggtttcatgataagaccgatagaagactttaacgaa
gttactcaccacatggccgagactatgtttgcacacctggctataacgaaaggactgaaa
cttcctgagcagttttccgatcatcaacaaggtaatcaaatgggcggagcttctagtttt
ggtagcactacacctcaagcaggcggaagtggctggaccccacttgcaaccagcactcag
atgagtggcacatcgtacggcaatcagttcaacagtggattaacattggtccaacaaaag
gttttaagtgtcattggtaatacaaaaggtgatcatggactacatgttaatgatataatt
agttctgtaaagactcaaggcttctctgatgcaagcataaagactgctcttgattttctg
tccaatgaaggccatgtatactccacaattgatgagcaacatttcaaatcaacagaagat
gtttaa

DBGET integrated database retrieval system