KEGG   Amphimedon queenslandica (sponge): 100634744Help
Entry
100634744         CDS       T02284                                 

Definition
replication protein A 32 kDa subunit-like
Orthology
K10739  
replication factor A2
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100634744
   03420 Nucleotide excision repair
    100634744
   03430 Mismatch repair
    100634744
   03440 Homologous recombination
    100634744
   03460 Fanconi anemia pathway
    100634744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 324 aa AA seqDB search
MNFGGGYQSVGSSYGGGRGYQGGGSYDTFGGGGYMANEMGGGFTSPGGTTGTPGGKDSKR
GGFKNQATRPVTAAMLHRVTSPPGAEEIYLIDDEQVNQIVLVGEIVEVFESATSVMYKID
DRTGPPVEVRRWINAEEDSQFELERRAACREGIYVKIVGHIKMFNNQRTITGFMIRPIED
FNEVTHHMAETMFAHLAITKGLKLPEQFSDHQQGNQMGGASSFGSTTPQAGGSGWTPLAT
STQMSGTSYGNQFNSGLTLVQQKVLSVIGNTKGDHGLHVNDIISSVKTQGFSDASIKTAL
DFLSNEGHVYSTIDEQHFKSTEDV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaattttggaggtgggtaccagtctgtagggagctcttatggtgggggcagaggctac
caaggtggaggtagctatgatacttttgggggtggagggtacatggcaaatgaaatgggt
ggaggttttacctccccaggtgggacgacaggaacaccaggtggaaaagactcaaagaga
ggtggtttcaagaaccaggcgacaaggccagtaacagctgcaatgcttcatcgagttacc
tcaccacctggggcagaggaaatttacttaattgatgatgaacaagtaaatcagatagtt
ctggtcggtgagattgttgaagtatttgaatcagctacaagtgtaatgtataagattgat
gatagaacaggtccacccgttgaagtaagacgatggattaacgctgaagaggattcacaa
tttgaattagaaaggcgggcagcttgcagggaaggaatttatgtgaagattgttggtcac
attaaaatgtttaacaaccagagaacgatcacgggtttcatgataagaccgatagaagac
tttaacgaagttactcaccacatggccgagactatgtttgcacacctggctataacgaaa
ggactgaaacttcctgagcagttttccgatcatcaacaaggtaatcaaatgggcggagct
tctagttttggtagcactacacctcaagcaggcggaagtggctggaccccacttgcaacc
agcactcagatgagtggcacatcgtacggcaatcagttcaacagtggattaacattggtc
caacaaaaggttttaagtgtcattggtaatacaaaaggtgatcatggactacatgttaat
gatataattagttctgtaaagactcaaggcttctctgatgcaagcataaagactgctctt
gattttctgtccaatgaaggccatgtatactccacaattgatgagcaacatttcaaatca
acagaagatgtttaa

DBGET integrated database retrieval system