KEGG   Amphimedon queenslandica (sponge): 100634809Help
Entry
100634809         CDS       T02284                                 

Definition
dual specificity protein kinase CLK2-like
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
aqu  Amphimedon queenslandica (sponge)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 478 aa AA seqDB search
MLTTMCVRGNADGVSDKKKSSSLSSLSTSLPMQPLPSKDAILPSSSSSSSSSSKKKPRGF
KMVVGSSKKQSVKDKESHQSSSSRKEKDEVHRVPPPITPAKVEDDEDGHLIYKKGDYLDS
RYEVLRTLGEGTFGKVVCCHDRLTGKDVAVKIIKNVPKYRAAARIEIRVLEQIRDIVEDG
QELCVQLRDWFDYYGHISLTFDMLGLSVFDFLKDNNYHPYSLSQVRHISWQLIKAVRYLH
QTRLTHTDLKPENILFVSSDYDMYYDARKKQDIRVVKSTDVRLIDFGSATFDDEHHSTVV
STRHYRAPEVILELGWSHPCDMWSVGCIMFELYRGHTLFQTHDNLEHLAMMETILGPLPV
RFVRESRKSKYFWHGKLDWDPESPDGRYIREHCRKLKRYILSAEPEHEHLFDLITQLLTY
EPRKRMTASEALKHSFFAPYHTRSSTNNPTNSSSLVAQNKRNLSSQGSSSSSSSSDNE
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcttacaaccatgtgtgtccgtggaaatgctgatggggtcagcgataaaaagaaaagc
tcctcactctcttctctttcaacttctctcccaatgcagccactaccaagcaaagatgcc
attttaccttcctcatcatcatcgtcgtcatcatcatctaagaagaaacctagaggtttt
aagatggtcgttgggagcagtaaaaaacagtcggtaaaagataaagagtcccatcagtct
tcttcgtcaagaaaagagaaggatgaagttcacagagttccacctccaataacacctgct
aaagtggaggatgatgaagatgggcacttgatctataagaaaggagattatttggactca
agatatgaagttttaagaacattaggcgaaggaacatttggtaaagtcgtctgttgtcat
gataggttaactggcaaggatgttgccgtaaagataattaagaatgtccccaagtacagg
gcagctgcacggatagagatacgtgtccttgaacaaatcagagacatagttgaagatgga
caagagctatgtgtccagctcagagactggtttgattattatggtcacatctcactcact
ttcgatatgcttggactgagtgtctttgatttcctgaaagacaataactatcacccttac
tctttgtcacaagtcagacatatttcttggcagctcataaaagcagtccgatatttacat
cagacaagactgacacacactgaccttaagcctgagaatatcctttttgtcagctctgac
tacgacatgtactacgacgcaagaaaaaaacaggacattcgagttgtgaaatcgactgac
gtgagattgatagattttggttcagctacctttgacgatgaacatcacagcactgtggta
tcaacaagacactatagggcccctgaagtaatccttgaattaggatggtcccatccttgt
gacatgtggagcgtcgggtgtataatgtttgagctgtatcgaggccacaccctctttcag
acccacgataatcttgagcacctagcaatgatggagactatcctgggcccgctccctgtc
aggttcgtgagggagagcaggaagagcaagtacttctggcacgggaagttggactgggac
cctgagagtcctgacggacgctacataagagaacactgcaggaaacttaaacggtacatt
ctttcagctgaaccagaacacgaacatttatttgacctcatcacacagctactcacatat
gagccaagaaagagaatgacagcctctgaagctctcaaacattctttctttgccccctac
cacacccgctcttcaaccaacaacccaaccaattcttcaagtcttgtggcccagaacaag
agaaatctctccagccaaggatcctctagcagttccagttccagcgataacgagtga

DBGET integrated database retrieval system