KEGG   Amphimedon queenslandica (sponge): 100634809Help
Entry
100634809         CDS       T02284                                 

Definition
(RefSeq) dual specificity protein kinase CLK2-like
  KO
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100634809
Protein kinases [BR:aqu01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100634809
Spliceosome [BR:aqu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100634809
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 575 aa AA seqDB search
MSNYKRRREDESTFGFGRYPKRLRRDCNGYHTRDAHSLSVSYHSSFHAKNGAKSIPTDKN
NTYHYSLSSELYGRHYSGSKSTSIRYSSNCSNASQQQRERKRKRELAECVSEEFGKVRKA
MRSESSHQRKPLPSKDAILPSSSSSSSSSSKKKPRGFKMVVGSSKKQSVKDKESHQSSSS
RKEKDEVHRVPPPITPAKVEDDEDGHLIYKKGDYLDSRYEVLRTLGEGTFGKVVCCHDRL
TGKDVAVKIIKNVPKYRAAARIEIRVLEQIRDIVEDGQELCVQLRDWFDYYGHISLTFDM
LGLSVFDFLKDNNYHPYSLSQVRHISWQLIKAVRYLHQTRLTHTDLKPENILFVSSDYDM
YYDARKKQDIRVVKSTDVRLIDFGSATFDDEHHSTVVSTRHYRAPEVILELGWSHPCDMW
SVGCIMFELYRGHTLFQTHDNLEHLAMMETILGPLPVRFVRESRKSKYFWHGKLDWDPES
PDGRYIREHCRKLKRYILSAEPEHEHLFDLITQLLTYEPRKRMTASEALKHSFFAPYHTR
SSTNNPTNSSSLVAQNKRNLSSQGSSSSSSSSDNE
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgtctaactacaagagaaggagagaagatgaaagcacttttggatttggacgctacccg
aagcgtcttcgtcgggactgtaatggctaccacactcgtgacgctcactccctctctgtc
tcttatcattcttcatttcacgcgaaaaatggagcaaaatcgataccaactgacaagaac
aatacatatcactactccctctcatcagagctgtatggtaggcattactctgggtctaaa
tccacaagtatccgctactccagtaattgcagtaatgcctcccagcagcagagggagagg
aagaggaagagagaacttgcggaatgcgtctcggaagaattcggaaaagttaggaaagct
atgaggagtgaatcatctcaccagagaaagccactaccaagcaaagatgccattttacct
tcctcatcatcatcgtcgtcatcatcatctaagaagaaacctagaggttttaagatggtc
gttgggagcagtaaaaaacagtcggtaaaagataaagagtcccatcagtcttcttcgtca
agaaaagagaaggatgaagttcacagagttccacctccaataacacctgctaaagtggag
gatgatgaagatgggcacttgatctataagaaaggagattatttggactcaagatatgaa
gttttaagaacattaggcgaaggaacatttggtaaagtcgtctgttgtcatgataggtta
actggcaaggatgttgccgtaaagataattaagaatgtccccaagtacagggcagctgca
cggatagagatacgtgtccttgaacaaatcagagacatagttgaagatggacaagagcta
tgtgtccagctcagagactggtttgattattatggtcacatctcactcactttcgatatg
cttggactgagtgtctttgatttcctgaaagacaataactatcacccttactctttgtca
caagtcagacatatttcttggcagctcataaaagcagtccgatatttacatcagacaaga
ctgacacacactgaccttaagcctgagaatatcctttttgtcagctctgactacgacatg
tactacgacgcaagaaaaaaacaggacattcgagttgtgaaatcgactgacgtgagattg
atagattttggttcagctacctttgacgatgaacatcacagcactgtggtatcaacaaga
cactatagggcccctgaagtaatccttgaattaggatggtcccatccttgtgacatgtgg
agcgtcgggtgtataatgtttgagctgtatcgaggccacaccctctttcagacccacgat
aatcttgagcacctagcaatgatggagactatcctgggcccgctccctgtcaggttcgtg
agggagagcaggaagagcaagtacttctggcacgggaagttggactgggaccctgagagt
cctgacggacgctacataagagaacactgcaggaaacttaaacggtacattctttcagct
gaaccagaacacgaacatttatttgacctcatcacacagctactcacatatgagccaaga
aagagaatgacagcctctgaagctctcaaacattctttctttgccccctaccacacccgc
tcttcaaccaacaacccaaccaattcttcaagtcttgtggcccagaacaagagaaatctc
tccagccaaggatcctctagcagttccagttccagcgataacgagtga

DBGET integrated database retrieval system