KEGG   Amphimedon queenslandica (sponge): 100635273Help
Entry
100635273         CDS       T02284                                 

Definition
ubiquitin carboxyl-terminal hydrolase 21-like
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100635273
Peptidases [BR:aqu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100635273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 636 aa AA seqDB search
MSNKMSTISHGRRSPSLNQSHRPVVSTQSRTPHRPPITTDSRTIVNRVREKVSQPPSSPC
LSDARKKRQNERRTDPKSSPVHSYSAPHYNYSSSSSFRTPITGTSSHNIAHDKRSSQSLN
TQRVNSDGRYHHHHGALANSVLHKTTPLWNAERETLVETNYLYRSHPAQPHTSYTSSYTG
ISSPSLKPRTSSISQTQSQTYASYSPSFNHTTTIAPAIGDTTGVRHIHRGSHSVDSIPVA
GIRTSPESSVSPLPRIPKRPSIDLVSAQLDSKVSSRKIVTVPSLLTSHSGLLGLYNSGNT
CYMNSVLQCLSHTRQMTEFFLSGDAKAEAAEATRTKARRSSLVNAYTEFLEQMWKPKDDK
AVTPNHLRSAMSSLIPMVRTSEQQDAQEFLQFLLCCLHEETNKPKKRLESSESSSSTNLT
PSELARSSWKRSLSYDNSYLSDLFMGQVRSTLTCTTCRNTSLSFESFWSLSLPLPSKSKS
HSSSLFITISDCFQLYSAEERLDSDNQPVCTKCKSSQPSTKKLDIQIFPKILILHLKRFT
VRNRYCTKLPSNVKVPTTVTVEEIAVDKESVKSFKYELYGIINHSGTISFGHYKAECKHS
GKWYTFNDRVVTSSSEAMITNPSASPYVLFYEKIDR
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacaaaatgtcaaccattagtcatggaaggcgttcaccttcactcaatcaaagt
cataggccagtggtatcaacacaatcacgtactcctcatagacctcccattactactgat
tcaagaactattgtaaacagagtgagagagaaagtatctcaacctccttcatcaccatgc
ctctccgatgcaaggaagaaacgacaaaatgagagacgaactgatcccaaatcttctcct
gttcattcttattctgcccctcactacaactactcctcttcctcatcttttagaactcct
atcactggtactagctctcataatatagctcacgataaacgaagcagtcaatctctcaat
actcaaagggtcaatagtgatggccgctatcatcaccatcatggggcattagctaatagt
gtgcttcataaaacgacgcctctctggaatgcagagagagaaaccttggtggaaacaaac
tacctttatcgtagtcacccggctcaaccccatactagttatacctccagttatacaggt
attagctcacctagtctgaaaccacgaaccagctccatatcacagacacagtctcagacc
tatgcctcttattcaccttcttttaatcacaccacaaccattgctcctgctataggagac
actactggggtaagacacattcatcggggtagccattcagttgatagtattcctgtggct
ggaataagaacttcacctgaaagttctgtatctcctctgcctcggataccaaagaggcca
tcaatagatctcgtttcggcacagctggacagtaaagtgtccagcaggaagatagtgaca
gttccatcattgcttacatcacatagtggactcctgggtctttacaactctggaaacaca
tgctacatgaactcggtccttcagtgtctgagtcacaccagacaaatgacagagttcttt
ctctcgggagatgcaaaggcagaggctgcagaagcaactagaaccaaagcaagaaggagt
tcactcgttaacgcttatacagaattcttagagcagatgtggaaaccaaaagatgataaa
gcagtaacgcctaaccatttacgctcagcaatgtcttccttaattccaatggtcaggact
agcgaacaacaagatgctcaagagttcctccagtttttactgtgttgtctacacgaggag
acaaataagccaaaaaagagactagagtcttcagaatcctcatcatcgactaaccttact
cctagtgaattggcacgctcatcttggaagaggagtctgagctatgacaacagttacctc
tcagatctcttcatgggtcaagttagaagtacactaacttgtactacctgtaggaacaca
tccttgagttttgagtcgttctggagtctttccttaccattaccctcaaaatcaaaatcg
cattcaagttccctattcatcactatatccgactgtttccagttatactcagcagaagag
agactagatagtgataatcaaccagtatgtaccaagtgtaaatcatcacagccaagcaca
aagaaactagatattcagatatttccaaaaattctcatattacatcttaaaaggttcacg
gttcgaaatagatattgtaccaaactgccctctaatgtaaaagtaccaactactgtcact
gtcgaggaaatagcagttgataaagaatctgttaaatcgttcaaatatgaattgtatggt
atcataaatcactccggtaccatttcattcggtcattacaaagctgaatgcaagcacagt
ggaaagtggtacaccttcaatgatagagttgtgacatcgtcttcagaggcaatgataaca
aatccctctgcatctccatatgtactcttttatgaaaaaatcgatcgataa

DBGET integrated database retrieval system