KEGG   Amphimedon queenslandica (sponge): 100635273Help
Entry
100635273         CDS       T02284                                 

Definition
ubiquitin carboxyl-terminal hydrolase 21-like
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
aqu  Amphimedon queenslandica (sponge)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 636 aa AA seqDB search
MSNKMSTISHGRRSPSLNQSHRPVVSTQSRTPHRPPITTDSRTIVNRVREKVSQPPSSPC
LSDARKKRQNERRTDPKSSPVHSYSAPHYNYSSSSSFRTPITGTSSHNIAHDKRSSQSLN
TQRVNSDGRYHHHHGALANSVLHKTTPLWNAERETLVETNYLYRSHPAQPHTSYTSSYTG
ISSPSLKPRTSSISQTQSQTYASYSPSFNHTTTIAPAIGDTTGVRHIHRGSHSVDSIPVA
GIRTSPESSVSPLPRIPKRPSIDLVSAQLDSKVSSRKIVTVPSLLTSHSGLLGLYNSGNT
CYMNSVLQCLSHTRQMTEFFLSGDAKAEAAEATRTKARRSSLVNAYTEFLEQMWKPKDDK
AVTPNHLRSAMSSLIPMVRTSEQQDAQEFLQFLLCCLHEETNKPKKRLESSESSSSTNLT
PSELARSSWKRSLSYDNSYLSDLFMGQVRSTLTCTTCRNTSLSFESFWSLSLPLPSKSKS
HSSSLFITISDCFQLYSAEERLDSDNQPVCTKCKSSQPSTKKLDIQIFPKILILHLKRFT
VRNRYCTKLPSNVKVPTTVTVEEIAVDKESVKSFKYELYGIINHSGTISFGHYKAECKHS
GKWYTFNDRVVTSSSEAMITNPSASPYVLFYEKIDR
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacaaaatgtcaaccattagtcatggaaggcgttcaccttcactcaatcaaagt
cataggccagtggtatcaacacaatcacgtactcctcatagacctcccattactactgat
tcaagaactattgtaaacagagtgagagagaaagtatctcaacctccttcatcaccatgc
ctctccgatgcaaggaagaaacgacaaaatgagagacgaactgatcccaaatcttctcct
gttcattcttattctgcccctcactacaactactcctcttcctcatcttttagaactcct
atcactggtactagctctcataatatagctcacgataaacgaagcagtcaatctctcaat
actcaaagggtcaatagtgatggccgctatcatcaccatcatggggcattagctaatagt
gtgcttcataaaacgacgcctctctggaatgcagagagagaaaccttggtggaaacaaac
tacctttatcgtagtcacccggctcaaccccatactagttatacctccagttatacaggt
attagctcacctagtctgaaaccacgaaccagctccatatcacagacacagtctcagacc
tatgcctcttattcaccttcttttaatcacaccacaaccattgctcctgctataggagac
actactggggtaagacacattcatcggggtagccattcagttgatagtattcctgtggct
ggaataagaacttcacctgaaagttctgtatctcctctgcctcggataccaaagaggcca
tcaatagatctcgtttcggcacagctggacagtaaagtgtccagcaggaagatagtgaca
gttccatcattgcttacatcacatagtggactcctgggtctttacaactctggaaacaca
tgctacatgaactcggtccttcagtgtctgagtcacaccagacaaatgacagagttcttt
ctctcgggagatgcaaaggcagaggctgcagaagcaactagaaccaaagcaagaaggagt
tcactcgttaacgcttatacagaattcttagagcagatgtggaaaccaaaagatgataaa
gcagtaacgcctaaccatttacgctcagcaatgtcttccttaattccaatggtcaggact
agcgaacaacaagatgctcaagagttcctccagtttttactgtgttgtctacacgaggag
acaaataagccaaaaaagagactagagtcttcagaatcctcatcatcgactaaccttact
cctagtgaattggcacgctcatcttggaagaggagtctgagctatgacaacagttacctc
tcagatctcttcatgggtcaagttagaagtacactaacttgtactacctgtaggaacaca
tccttgagttttgagtcgttctggagtctttccttaccattaccctcaaaatcaaaatcg
cattcaagttccctattcatcactatatccgactgtttccagttatactcagcagaagag
agactagatagtgataatcaaccagtatgtaccaagtgtaaatcatcacagccaagcaca
aagaaactagatattcagatatttccaaaaattctcatattacatcttaaaaggttcacg
gttcgaaatagatattgtaccaaactgccctctaatgtaaaagtaccaactactgtcact
gtcgaggaaatagcagttgataaagaatctgttaaatcgttcaaatatgaattgtatggt
atcataaatcactccggtaccatttcattcggtcattacaaagctgaatgcaagcacagt
ggaaagtggtacaccttcaatgatagagttgtgacatcgtcttcagaggcaatgataaca
aatccctctgcatctccatatgtactcttttatgaaaaaatcgatcgataa

DBGET integrated database retrieval system