KEGG   Amphimedon queenslandica (sponge): 100635301Help
Entry
100635301         CDS       T02284                                 

Definition
agmatinase, mitochondrial-like
Organism
aqu  Amphimedon queenslandica (sponge)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 342 aa AA seqDB search
MTALAKRLTSKLSKLSSGTRGIAYNVPTSPHQLPRFGGIATMMRLPLQQGDAKGLDACFV
GIPMDQGTSWRSGTRHGPRMIRNESNMMNQFHYSTGAAPFESLQVADIGDVPVNPYNVVK
TIDNIKEFYGNILKENCIPLALGGDHTLTLGTLRAMGEKYGPVAMIQVDAHSDTQDTMFG
EKIAHGTPFRRAVEDGVLDPKMSFQIGLRAYGYSPSDFKWSKEQGFHTTFAKDCYHKSLV
PLMDSIRDSIGPERPVYLTFDIDGIDPAYCPGTGTPEIGGLTIIQALEIVRGCCGLNIVG
ADLVEVNPLFDKSGTTAMTGANLLFEMLCILPGVKYYKDWNL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgactgctcttgcaaagaggctaacatctaaactcagtaaactgtcctcagggacaagg
ggaatagcatacaatgtccccacaagtccacaccagctacctcgttttggaggaatagcc
actatgatgcgactcccccttcagcaaggagacgctaaaggattggatgcatgttttgtt
ggtatcccaatggatcaaggtacctcatggagatcaggaactagacatggaccaagaatg
ataagaaatgagtcaaacatgatgaatcagtttcactactccacaggtgctgcccctttt
gagtcactgcaagttgctgatatcggggatgttcctgttaatccttacaatgttgtgaaa
actattgataacatcaaagaattctatggaaatattttaaaagagaactgcataccgctt
gccttgggtggtgatcacactcttactcttggtactctccgtgctatgggtgagaaatat
ggtccagttgctatgatccaagttgatgcacactctgatacacaggacacaatgtttggg
gaaaagatagcacatgggacgccatttagacgtgcagtcgaggatggtgttcttgatcct
aaaatgtcatttcaaattggcctaagagcttatggctacagtccaagtgattttaaatgg
tcaaaggaacaaggttttcatacaacatttgctaaagattgctatcacaaatcactcgtt
cctctgatggactccattagagattcaataggacctgagagaccagtgtatttgacattt
gatattgatggcattgatccagcatactgtcctggaacaggtactcctgaaattggaggt
ttgactatcattcaagcactagaaatagttcgaggctgttgtggtttgaacattgttggg
gcagatcttgttgaagttaatcctttatttgataaatccggtactactgcaatgactgga
gctaatcttcttttcgaaatgttgtgtatactgcctggtgtcaagtattataaagactgg
aacttataa

DBGET integrated database retrieval system