KEGG   Amphimedon queenslandica (sponge): 100635460Help
Entry
100635460         CDS       T02284                                 

Definition
probable ubiquitin carboxyl-terminal hydrolase FAF-X-like
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
aqu  Amphimedon queenslandica (sponge)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 939 aa AA seqDB search
MVTFVRTGLDYLWDCVLQVNDSISSKPIELMKDIFTNLSSKLPQEQIHQEFISVCMQRMD
IINKVLYQYKPHELVTEASDQVNKLVRCLKLLLEYIVECDNEHMEERGIPPHGKSYWGKP
LSLTIRYCSTPNSQPEDFDIWTHHNDTIASLRRQIARKINVHDSSKLELVVGNEIIRKNE
NYRYVIAASIPLRDKMVVTVRLHQYSNISETSMQSSDNSTDSSDASTGQHDGPNFDTEKV
LPSVLMADKDDYIDFLLRLCDFAVERQLVILRDNVRSLLKLLPTGIRLLKEMLIFCKEKS
TEEDRYKQLESFVLCGSPSKTVYLIEIIHSMIMPSVDNRDIESSEFQHNFILCGGLKLMF
HVLTSNDCLSRADNTLKRSAYLSCLKVLKLLLVAQGYSFILSVSQEIKSNTEAMRGPRYK
SAVGIQEAMSTIVSTVDTKLKTVATILAKSLCTNLMSPLPDVDVIVSLQMLIWSSIIGDI
SLMNKPNEIHKEFEKRCVSGPLDSEVLQLIREGLETLSLSMAVSNTILDTHHTTEPWKQF
IIDIVLTARNRLIRMTAQDQLFNIITKCCTDSVPVLISTIKLLFNALETIVSDHSSTSNE
FFRLLARLINHAHCHQVSVDGIQKLLDIELKWLEGVRVNSLSSQSVVVEGPLLEGHLNLI
VELLTFSSIEERHSLGSKPGGMNLIPNLINHFLFPASRLVKKLKTTPDLQYNDELASGIC
SSPDSIQACYKLLNALCVGVKENIEILSELISDIFYNDELPLVEWEYYPHVGPRPTRGYV
GLKNAGATCYMNAVLQQLYMISPVRNGVLSLSEPAVQLINETDKTEQDNKGKSVDGPLVP
ASTDRKETHIKVLMQLQTIFGHLLEGKVQFYVPKGFWKDFRLEGQQVNLREQHDAFEFFN
TLVDSVDEGLKAYNATPIISKVLGGSFADQKICKGCPHR
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atggtaacctttgttcgtacaggtcttgattacctgtgggactgcgtccttcaagttaat
gacagcatatcctccaaacccattgaactcatgaaggatatattcactaacctctcctcc
aaactacctcaggaacaaatccaccaggagttcatcagtgtgtgtatgcagagaatggat
atcattaataaagtattgtaccagtataagcctcatgaactagtgactgaggcttctgat
caagttaataagcttgttaggtgtttaaagctgctgctggagtatattgtggagtgtgac
aatgaacacatggaggagagagggataccacctcatgggaagtcctattggggtaagccc
ctctcattaaccatcagatattgttcaactccaaactcacaacctgaggactttgatata
tggacccatcataatgacaccatagcatcactgaggagacagatagcaaggaaaatcaat
gttcatgattcctcaaagttggagttggtcgttgggaatgagatcattcgtaaaaatgag
aactacagatatgtcattgcagccagcatacctctgagggataaaatggttgtcacagtg
agactgcaccagtacagtaacatcagcgagacctcaatgcaatcttctgataattcaact
gattcatctgatgcttccactggccagcatgatgggcctaactttgatactgagaaggtt
ctaccatcagtcctaatggctgataaagatgactatattgatttcttgcttcgattgtgt
gattttgctgttgagcgtcagctagtgatcctgagagataacgttaggagtttattgaaa
ttactacccacaggtattaggttacttaaggagatgttgatattttgtaaggagaaatca
actgaagaggatcgttataaacaacttgaatcatttgtactttgtggtagcccttcaaaa
actgtatacctaattgagattattcattccatgataatgccatcagttgataatcgtgat
attgagagctcagagttccagcataacttcatactgtgtggtggactgaagctaatgttt
catgtactcacttctaatgactgtctctctagagctgacaacacactcaagaggtcagct
tacctcagttgtcttaaagtgttaaagttactcctggtagcacagggctactccttcata
ctctcagtatcacaagaaataaaatcaaacactgaggcaatgagaggtcccagatacaag
tcagcagttggtatccaagaggctatgagcaccatagtatccactgttgatactaaacta
aagactgtggcaaccatactggccaaatcactctgtaccaatttgatgagtcccctacct
gatgttgatgtcattgtttcattacaaatgttgatatggtccagtatcattggagatata
tcattaatgaataaacctaatgagattcacaaggaatttgaaaagaggtgtgtatcgggt
ccattggattcagaggtgctccagttgataagagaaggactggagaccctctccctctca
atggcagtctctaacactatactggacacccaccacaccactgagccatggaaacaattc
atcattgatattgtactcactgccaggaacaggttaataaggatgacagctcaggatcag
ttgttcaatataatcactaaatgttgcactgactcggtcccagtattgatcagcactatc
aaactactcttcaacgctttagagactatagttagtgatcattcttcaacatcaaacgaa
ttcttcagattattagcaaggttaattaaccacgcccactgtcaccaggtatcagttgat
ggtattcagaagttgttggatattgaactgaagtggctggagggagtgagagttaattcc
ttgtccagtcagtctgtggtggtggagggtccattattggaaggtcatttgaatcttatt
gtggagctgctgacgttttcctcaattgaagagagacacagtttagggagtaaaccaggg
ggaatgaacctcatacctaacctcatcaatcatttcttgtttcctgcatcaagattagtg
aagaaactaaagactacacctgatctacagtacaatgatgagttagccagtggtatatgc
tccagtcctgacagtattcaagcttgttataaactattgaatgcactgtgtgttggagtg
aaggagaacattgaaatactcagtgaactaatctctgatatattctacaatgatgagctt
ccattggtggagtgggagtattatcctcacgttggtcctcgacccactagagggtatgtg
ggactgaagaatgctggagctacctgctatatgaacgctgtactacaacaattgtacatg
atctctccggtcagaaatggtgtcctctcgctatcagagccagcagtccagttgattaac
gaaactgacaaaacagaacaagacaataaaggaaaatcagtagatggtccactggtccct
gctagtactgaccggaaggagacgcacattaaggtactgatgcaactacagaccatattt
ggacatctactggaagggaaggttcaattttatgtacccaaaggattctggaaggacttc
aggttggagggtcaacaggttaatctgagagagcagcatgatgcctttgagttcttcaat
actctagtggacagtgtagacgagggactcaaggcttataatgccacaccaatcatcagt
aaagtactgggaggatccttcgctgatcagaaaatatgtaaaggatgtcctcacaggtag

DBGET integrated database retrieval system