KEGG   Amphimedon queenslandica (sponge): 100635463Help
Entry
100635463         CDS       T02284                                 

Definition
histone H2B, gonadal-like
Orthology
K11252  
histone H2B
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Exosome [BR:aqu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100635463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 122 aa AA seqDB search
MPPKVSAKGAKKAGKAKAARSGDKKKKRRRKESYSIYIYKVLKQVHPDTGVSSKAMSIMN
SFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS
SK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaaaggtttctgccaaaggggctaagaaagccggaaaagcaaaggccgcacgt
agcggagacaagaagaagaaacgacgacgaaaggagtcttacagcatctacatctacaaa
gtgctgaaacaagtccaccccgacactggagtcagcagcaaagctatgtctatcatgaac
agtttcgtcaacgacattttcgagagaatcgctgccgaagcttcaagactcgctcactac
aacaaaagatcgaccatcaccagcagggaaatccaaactgccgttcgacttctgttaccc
ggtgagctcgccaagcacgccgtttccgaaggaacaaaggccgtcaccaaatacaccagc
tccaaataa

DBGET integrated database retrieval system