KEGG   Amphimedon queenslandica (sponge): 100635508Help
Entry
100635508         CDS       T02284                                 

Definition
(RefSeq) monoglyceride lipase-like
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100635508
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100635508
Peptidases [BR:aqu01002]
 Serine Peptidases
  Family S33
   100635508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 484 aa AA seqDB search
MATTSEDLKEVPEGETASPEDPKKEGQSDQTSNSEVIATSGTNETSDQDQPNVDANTDNS
DVNQPNADTDQPNADADQPNADTDQPNADADQPNANTDQPNADADLPNTNADANQPNANA
DADQPNADADQPNTDANQPNADADQPNADANQPNADANQPNADADQPNADADPPNADADP
PNADADQPNADADQDPKEDTRRRSVYCNQPLETYIWKPEAQDIKGLVCICHGVHEHMGRY
EKLAEHLKSSGLLVFGIDLVGHGKSEGVRGSIDDMQSYATDVIGFAQEMEEKYPEQPMFL
MGHSMGGLVATIVAIQRQSMFIGLLLSAPSLMVDPNEAGPIKRLLARIIGAIAPNFGIST
LNTSTISSLPEEVAEYVNDPLIIHAPLKAGWGLAFMKGIQYVEGRLGDISIPLFIMHGSD
DQLVPMAASELVHNNASSTDKTLEVFIDCRHEILHDKEQDRARQLISTWILSRITSKQET
APDN
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcaactacaagtgaagacttaaaggaggtaccagaaggagaaacagcctctcctgaa
gatcctaaaaaagaaggacaatctgaccagaccagtaactctgaagtgattgctaccagt
ggtactaatgaaacctctgatcaagatcaacccaacgttgatgctaacactgataactct
gatgtcaatcaacctaatgcagataccgatcaacctaatgctgatgccgatcaacctaac
gctgataccgatcaacctaatgctgatgccgatcaacctaacgctaatactgatcaacct
aatgctgatgctgatctacctaacactaatgctgatgccaatcagcctaatgctaatgct
gatgctgatcaacctaatgctgatgccgatcaacctaacactgatgccaatcaacctaac
gctgatgccgatcaacctaacgctgatgccaatcagcctaatgctgatgccaatcagcct
aatgctgatgccgatcagcctaatgctgatgctgatccacctaacgctgatgctgatcca
cctaatgctgatgccgatcaacctaacgctgatgctgatcaggatccaaaagaagataca
agaaggagaagtgtctattgcaatcaaccactggagacatatatctggaaaccagaagca
caagatataaagggattggtttgtatctgtcatggtgttcatgagcacatggggcgttat
gagaaactagccgaacacttaaaatcctcaggtctcttggtttttgggattgacttagtt
ggtcacggtaaaagtgaaggggttagaggatctattgatgatatgcaatcatatgcaacc
gatgtgattggatttgcacaagaaatggaagaaaaatacccagaacaaccaatgtttcta
atgggacactcaatgggcggcttggtagctaccatagttgctattcaaaggcagagcatg
ttcataggcctccttctctcagctccatcgctaatggtggatcctaatgaagcagggcct
ataaagagattgcttgcaaggatcattggagccattgcacctaattttggtatatcaact
cttaatacttctacaatttctagtcttccggaagaagttgcagagtatgttaatgatcca
ctgataatccacgctcctcttaaagccggttggggcttggctttcatgaaagggatacaa
tacgttgaaggaaggcttggggacatttcaattcctctgtttataatgcatggatctgat
gaccaacttgtcccaatggctgcgtctgaattggttcataataatgcttcaagcacagat
aaaacactagaggtgtttattgattgtcgtcatgaaatactccatgacaaagagcaagat
agagctcgtcagctcatctctacctggatattgagtagaattacaagcaagcaagaaaca
gcacctgataattaa

DBGET integrated database retrieval system