KEGG   Amphimedon queenslandica (sponge): 100635536Help
Entry
100635536         CDS       T02284                                 

Definition
uncharacterized LOC100635536
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100635536
Protein kinases [BR:aqu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100635536
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 901 aa AA seqDB search
MASPGQQSGERRQEKMEVHQIQTEKKPQETQKPQNSQTLDNQRLGVEEKSIPGTSEMILV
RSSNSPKPSTGTSDKRVYTIKHRSMSVKFECDSRYTPLESIGTGAYGVVCAAKDNRTGRK
VAIKKIPRAFDEVVTAKRTYRELKILRHLRHENVISILDVMEPPENESSLQDVYVILDLM
ETDLHHIIHSVQPLSDDHIKYFLYQIGRGLKYIHSANIIHRDLKPSNLLINRNCELKIGD
FGMARGLSSTPEDHALFLTEYVATRWYRAPELMLSFSQYDISLDMWSVGCIFAEMLGRRQ
IFPGKNYVNQLQLVLSVVGTPSDEYINNIGSERVKTYLKSLPKKQPVDLFVLFPKANKVA
LELLEKLLQLDPRKRYIAIEILGHPYLSLYHDITDEPICTPPFDFTFEKTLDTKELLRSA
VVDELKEYHKCRIPIPPTNQVRDALKKMMEEREQKSSEGGEPEKREQKEVAAVKKKRLDE
RKRRTPDHQIHGPEKPKKKQKVYSPLTDSDRTALEHWNKLAVAVSNTTKKKGQETEEILS
LQQQQELLIKQQAEQLEKQQKQMVEQQRRIQQQSEQIRQLVHHQKVLIRECKAAGIKIPL
STPNPSPLSQAGLVSSPLTNASITTVKLTPPVQAHPLPIVKPHPFPVQPHPPPFDPGSLI
RTDVPVSPVNNSTTSNSQSSSVPPATATHAINYQNQPPVVAPPPTVAPPTAIAPPTSSIT
YPLPVPSYSTMLPTDSYPPHGPPLPLPQSPPDFMSSYIPVLPAQPSVPPDRSVPYCGPPA
EFFSPLTSKELVELTSQEMRKLSPYIPQSIDSFVPPLQEDLEKMFNVPPGGTFGGGYGVG
ISDDELTIMVPDNKIEGPPSASLLQEWLQDIDDIDSQGLQALQQEMEFGASEMFFRELEK
L
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcacctggtcagcaatctggagaaaggagacaagaaaagatggaggtccatcaa
atacaaacagaaaagaagccccaggagacacaaaagcctcaaaacagccaaacactggat
aaccagaggctgggggttgaggagaagagtatcccggggacatcagaaatgattctagtt
agatcaagcaactcgccaaaacccagcactggcacttcagataaacgagtgtacacgata
aagcacaggagcatgtcagtcaagtttgagtgtgactctcgctacactccattggagagc
attggtacaggagcctatggagtagtctgtgctgccaaagacaacagaaccggtcgcaag
gtagccatcaaaaagataccaagagcctttgatgaagtagtgaccgctaaaaggacttac
cgtgagctcaagatcttgcgccatttgaggcacgaaaacgtgatatcaatacttgatgtt
atggaaccgccggagaatgaaagcagtcttcaagacgtgtacgtgatactagacctcatg
gagacggacttgcatcacatcatccactcggtccagcctcttagtgacgaccacattaaa
tactttttgtaccaaataggacgaggattgaagtacattcattccgctaatataatccac
cgagacctgaaacccagtaaccttctcatcaatagaaactgcgagttgaagattggggat
tttggaatggcccggggactctcctctactccagaggatcatgccctctttttaacggaa
tacgtagctaccaggtggtacagggctccggaactaatgctctcctttagtcagtacgat
atatcactggacatgtggtctgttgggtgtatatttgctgagatgctgggtagacgacag
atattccctgggaagaactacgtgaaccagttgcagctggttcttagtgtagtgggtact
ccgtctgatgagtatattaataatatcgggtctgaacgtgtcaagacttatcttaagtct
cttccaaagaagcaacctgtggatttatttgttctgtttccaaaagctaataaagtagcg
ctggaattattggagaagttgttgcagctggacccaagaaagaggtacattgctattgag
atattgggacatccttacctctccctgtatcacgatataactgatgaacctatttgtacc
cctccctttgacttcacctttgaaaagactctagacacaaaagagttattaagatcagct
gtggtcgatgagttgaaagagtatcacaagtgtcgtattcctattccaccgaccaatcag
gttagagacgctctgaagaagatgatggaggagagagaacagaaatcaagtgaaggagga
gagccagagaagagagagcagaaagaagtggcagctgtcaagaagaaaaggttggatgaa
agaaagagacgaactcctgatcatcagatccatggaccagagaaaccaaaaaagaaacaa
aaagtgtattctcctttaacggacagtgaccgtacggcactagagcactggaacaaacta
gcggtggctgtttctaacacgactaaaaagaaaggacaggagacagaggaaatactctca
ctacagcagcaacaagaactactgataaagcaacaagctgaacaacttgagaagcaacag
aaacaaatggtggagcagcagcgacggatacagcaacagtcagagcagattaggcagttg
gtacatcatcaaaaggttttgatacgcgagtgcaaggcagctggaattaaaatacctctt
agtactccaaacccgagcccactctctcaagcaggtctagtttcttctcctttgactaat
gcaagtataacaactgtgaaactcacacctcctgttcaggcacacccactacctatagtg
aagccacacccatttcctgttcaaccacacccacctccatttgacccagggtctttgatc
aggactgacgtaccagtatctcctgttaataactcaacaacatcaaactctcaatcatca
tcagttcctcctgcaacagccacccacgcaattaattatcaaaatcagccaccagtagta
gctccacctccaacagtagctccacccactgcaatagctccgcccacttcctccatcact
tatcccctacctgtcccatcttattccacgatgctcccaactgatagctacccacctcac
ggacctcctctccctcttcctcaatctcccccagactttatgtcctcttatattccagta
ctgccagcccagccttcagtacctcctgatcgctctgtcccttactgtggacctccggct
gagttcttctctcctcttacatctaaagaacttgttgaattgacatcgcaggaaatgaga
aaactctctccttatatcccacagtccattgattcttttgtccctccgctacaagaggac
ctggagaagatgtttaatgttcccccagggggcacttttggtgggggctatggggttggt
atttctgatgatgaactaactataatggtaccagataataaaattgagggtcctccttca
gctagtttactgcaggaatggctacaggatattgatgatattgattctcaaggacttcag
gcactccagcaagaaatggagtttggagcttctgaaatgttcttcagggaacttgagaaa
ttatag

DBGET integrated database retrieval system