KEGG   Amphimedon queenslandica (sponge): 100635575Help
Entry
100635575         CDS       T02284                                 

Definition
protoporphyrinogen oxidase-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100635575
Enzymes [BR:aqu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     100635575
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 474 aa AA seqDB search
MKQRVVILGGGISGLTSAWSLARSSSKHEIILLESSERLGGWINSERMANNGAVHELGPR
SMRVAGSAGKTALAMMSELGLESKVIPIKRGHKAAQRRLIYTNRHKLVELPSNVSWLFKT
KPPFTKPLLAAVAKEPFIKAEPEGRDESVHQFISRRFGAEVAHWLINPMCRGIFAGDSKR
LSLKSCFPLLHGYEQKHGSIIKGMLRGKKCDADSNELVIKSKEEKWMIYTLENGLQTLTD
TLKTEAERLGVLIRTNTPATSISFGANNKAIIKTNGQEYNADHVIATISAQQLAKILPTN
QSKLCSSLSSIPLVDVAVVNVEFEGGAVPIQAFGYLVPSHQKSDILGTVFDSATFPELNR
KEAIPTTRLTVMMGGEWFQELFGDPETIRSSTLSDIALKSLHTQLGISSDPLDCIATIQK
SCIPQYTVGHSQRLDVINDCIKDLPISLLGASYNGVSVNDCIANSLLEVKKILN
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaagagttgtaatccttggtggaggaataagtggactaaccagcgcctggtca
ctggcaagaagtagctcaaaacatgaaataattctactagagtccagtgagaggctgggt
gggtggataaacagtgagagaatggcaaacaatggggctgtacatgagctagggccaagg
agcatgagagtagcaggaagtgcgggaaagactgcattagctatgatgtcagagttaggt
ctagagtcaaaggttattccgatcaagagaggacacaaagcagctcagagacgtctcata
tacacaaaccgacacaaactagtcgaactgccgtcaaatgtttcatggctattcaaaaca
aagccgccgttcaccaaacctttgctagcagctgtagccaaagagccgtttattaaagca
gaacctgagggaagagatgagagtgtgcatcagtttattagcaggagatttggagctgag
gttgcacactggctcattaatcctatgtgtcgtgggatttttgctggtgattcaaaacgc
ttaagtctcaaatcgtgttttcctttactgcatggctacgaacagaagcatgggtctatc
atcaaaggaatgctaagaggaaagaaatgtgatgctgatagcaatgaacttgtcattaag
tcaaaggaagagaaatggatgatctatacgctagagaatggactacagactcttacagat
acactgaagacagaggctgagagacttggcgttctcatacgtactaacacacctgctact
agcatttcatttggtgctaataataaagctataataaaaactaatggacaggaatataat
gcagatcatgtaatagctacaatttcagctcaacagctggcaaaaattttaccaaccaac
cagtcaaaattatgctctagtctgagctcaataccattagttgatgtagctgttgttaat
gttgaatttgaaggtggtgctgtacctatacaggcatttgggtatttggttccatctcac
caaaaatcagatatcttaggaacagtttttgactcggccacttttcctgaacttaatagg
aaagaagccattccaaccaccagactaacagtaatgatgggaggggagtggtttcaagag
ctgtttggtgacccggagaccataagaagcagtactttgtcagatattgcattaaaatca
cttcatactcaacttggcatatcatcagatccactagactgcattgctacaatacaaaag
tcatgtattcctcaatatactgttggacatagtcaaagactggatgttatcaatgattgt
attaaagatttaccaatttctttgctcggagcatcatataatggtgtcagtgtcaatgac
tgcattgcaaattcccttttagaagtgaagaaaatactcaactaa

DBGET integrated database retrieval system