KEGG   Amphimedon queenslandica (sponge): 100635575Help
Entry
100635575         CDS       T02284                                 

Definition
protoporphyrinogen oxidase-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:aqu00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 474 aa AA seqDB search
MKQRVVILGGGISGLTSAWSLARSSSKHEIILLESSERLGGWINSERMANNGAVHELGPR
SMRVAGSAGKTALAMMSELGLESKVIPIKRGHKAAQRRLIYTNRHKLVELPSNVSWLFKT
KPPFTKPLLAAVAKEPFIKAEPEGRDESVHQFISRRFGAEVAHWLINPMCRGIFAGDSKR
LSLKSCFPLLHGYEQKHGSIIKGMLRGKKCDADSNELVIKSKEEKWMIYTLENGLQTLTD
TLKTEAERLGVLIRTNTPATSISFGANNKAIIKTNGQEYNADHVIATISAQQLAKILPTN
QSKLCSSLSSIPLVDVAVVNVEFEGGAVPIQAFGYLVPSHQKSDILGTVFDSATFPELNR
KEAIPTTRLTVMMGGEWFQELFGDPETIRSSTLSDIALKSLHTQLGISSDPLDCIATIQK
SCIPQYTVGHSQRLDVINDCIKDLPISLLGASYNGVSVNDCIANSLLEVKKILN
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaagagttgtaatccttggtggaggaataagtggactaaccagcgcctggtca
ctggcaagaagtagctcaaaacatgaaataattctactagagtccagtgagaggctgggt
gggtggataaacagtgagagaatggcaaacaatggggctgtacatgagctagggccaagg
agcatgagagtagcaggaagtgcgggaaagactgcattagctatgatgtcagagttaggt
ctagagtcaaaggttattccgatcaagagaggacacaaagcagctcagagacgtctcata
tacacaaaccgacacaaactagtcgaactgccgtcaaatgtttcatggctattcaaaaca
aagccgccgttcaccaaacctttgctagcagctgtagccaaagagccgtttattaaagca
gaacctgagggaagagatgagagtgtgcatcagtttattagcaggagatttggagctgag
gttgcacactggctcattaatcctatgtgtcgtgggatttttgctggtgattcaaaacgc
ttaagtctcaaatcgtgttttcctttactgcatggctacgaacagaagcatgggtctatc
atcaaaggaatgctaagaggaaagaaatgtgatgctgatagcaatgaacttgtcattaag
tcaaaggaagagaaatggatgatctatacgctagagaatggactacagactcttacagat
acactgaagacagaggctgagagacttggcgttctcatacgtactaacacacctgctact
agcatttcatttggtgctaataataaagctataataaaaactaatggacaggaatataat
gcagatcatgtaatagctacaatttcagctcaacagctggcaaaaattttaccaaccaac
cagtcaaaattatgctctagtctgagctcaataccattagttgatgtagctgttgttaat
gttgaatttgaaggtggtgctgtacctatacaggcatttgggtatttggttccatctcac
caaaaatcagatatcttaggaacagtttttgactcggccacttttcctgaacttaatagg
aaagaagccattccaaccaccagactaacagtaatgatgggaggggagtggtttcaagag
ctgtttggtgacccggagaccataagaagcagtactttgtcagatattgcattaaaatca
cttcatactcaacttggcatatcatcagatccactagactgcattgctacaatacaaaag
tcatgtattcctcaatatactgttggacatagtcaaagactggatgttatcaatgattgt
attaaagatttaccaatttctttgctcggagcatcatataatggtgtcagtgtcaatgac
tgcattgcaaattcccttttagaagtgaagaaaatactcaactaa

DBGET integrated database retrieval system