KEGG   Amphimedon queenslandica (sponge): 100635886Help
Entry
100635886         CDS       T02284                                 

Definition
transforming acidic coiled-coil-containing protein 3-like
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100635886
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 574 aa AA seqDB search
MEGEGRGGGETLSATPTATDISNSRSPIAPAFTTTTGATTNILTESQKPNLIMSETETFK
TGQVPGSPGVGGGGWDDIRELDNAENWTERTRVISKQDHQFYSQCAQGFVSELVDKLPDK
STKEDYNDYGITGDNEVPNSRSPSNPSATTTGGGGDFGYMDQFDDRDFQLSASQFNTDYF
ERMGSNTNTTTSALARESLYVKFDPLVGPVVPARTTPPLPPPMSGDNLLMLNTPPTATFT
KSSVIGSEATPQTGTRDLMQSPNLLHMTGGNNDNMRMSPFASQSPFPKTLLDTSSSPSSN
YLIGQSPSANPNISGPGLHLPPARSSLEGNPELVKVLKYTDYDLQRIIAQVRQEAQAEIE
SQVLAVREEYSQEFQKSQKKMDRLVKELQNLRSNNALQTSSNSKMEEECSKLKALCDEHL
ATEKKMLDMYEKLKEESRQIEQQRDQALADFNSMEKSFADFHQRHIKARETLTLLQKSES
SLQDHIAHLEKKVESLEEMNQQLQDETFLKIQEANKIYDKLQSDHASELAVTKANVKKMT
VQISSLEGQLKQKEQEKQELTLICDELMKELGSK
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggaaggggaaggaagaggaggtggagaaacgttatctgctacacccaccgccactgat
atctctaatagtcgctcacccattgctcctgcctttactactactactggagctactact
aacatactgacagagtcacagaagccaaatcttataatgtcagagacagagactttcaag
acaggacaggttcctggtagtccaggggtaggaggaggagggtgggatgatatcagagag
ttggataacgccgagaattggacagagaggacacgagttatatcaaagcaggatcatcag
ttttactcgcagtgtgcacaaggttttgtttcagagcttgttgacaagctaccggataaa
agtacaaaagaagactataatgattatggtattactggcgacaatgaagtacctaattca
agatctccttcaaatccttcagcaacaacaacgggaggaggaggtgattttggttatatg
gatcagtttgatgatcgcgattttcaattatcagcttctcagtttaacactgattatttt
gagaggatgggctctaatactaatacaactaccagtgccctagccagagagtccttatat
gttaagtttgatccgttagtaggtccagtggtaccagcacgtactactcctcctctccct
ccccccatgagcggcgataatcttctcatgcttaacacacccccaacggcaacttttacg
aaatcatcagtgattggttcggaagccacgccccaaacagggacacgggacttgatgcag
agcccgaacttgttacacatgactggagggaacaatgataatatgagaatgtctcctttt
gcatcacagagtccgttccccaagacactattagacacttcctcctctccatcttctaac
tacctcattggtcagtccccttcagctaatcccaatataagtggacctggtcttcactta
ccaccggcacgctcatctcttgagggtaatccagaactagtcaaggtgttaaaatatact
gattatgacttgcagaggattattgctcaagtcaggcaagaagcacaggcagaaattgag
agccaagttcttgctgtgagagaagaatattcacaggagttccaaaaatcacagaaaaag
atggacaggctggtcaaagaacttcaaaatttgaggtcaaacaatgcactccagacatca
agcaactctaaaatggaagaagagtgctcgaaattgaaagccctgtgtgatgaacatctt
gccactgaaaagaagatgcttgacatgtatgagaaactaaaggaagagagcagacagata
gagcagcaaagagatcaggctcttgctgatttcaattccatggagaagtcgtttgcagat
tttcaccaaagacacataaaagcacgcgagactttgacattattacagaaatctgagagc
tcattacaagaccatattgctcacctggagaagaaagttgaatcattagaagaaatgaat
cagcagctgcaagatgaaacattcctaaaaatacaagaggccaataagatatacgataag
ctacagtctgatcatgcatcagagctagcagtgacaaaagcaaatgttaaaaagatgaca
gttcaaatatcaagccttgaagggcaactgaaacaaaaggaacaagagaagcaagagttg
actcttatatgtgatgagctaatgaaggaactgggaagcaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system