KEGG   Amphimedon queenslandica (sponge): 100635886Help
Entry
100635886         CDS       T02284                                 

Definition
transforming acidic coiled-coil-containing protein 3-like
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:aqu03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 574 aa AA seqDB search
MEGEGRGGGETLSATPTATDISNSRSPIAPAFTTTTGATTNILTESQKPNLIMSETETFK
TGQVPGSPGVGGGGWDDIRELDNAENWTERTRVISKQDHQFYSQCAQGFVSELVDKLPDK
STKEDYNDYGITGDNEVPNSRSPSNPSATTTGGGGDFGYMDQFDDRDFQLSASQFNTDYF
ERMGSNTNTTTSALARESLYVKFDPLVGPVVPARTTPPLPPPMSGDNLLMLNTPPTATFT
KSSVIGSEATPQTGTRDLMQSPNLLHMTGGNNDNMRMSPFASQSPFPKTLLDTSSSPSSN
YLIGQSPSANPNISGPGLHLPPARSSLEGNPELVKVLKYTDYDLQRIIAQVRQEAQAEIE
SQVLAVREEYSQEFQKSQKKMDRLVKELQNLRSNNALQTSSNSKMEEECSKLKALCDEHL
ATEKKMLDMYEKLKEESRQIEQQRDQALADFNSMEKSFADFHQRHIKARETLTLLQKSES
SLQDHIAHLEKKVESLEEMNQQLQDETFLKIQEANKIYDKLQSDHASELAVTKANVKKMT
VQISSLEGQLKQKEQEKQELTLICDELMKELGSK
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggaaggggaaggaagaggaggtggagaaacgttatctgctacacccaccgccactgat
atctctaatagtcgctcacccattgctcctgcctttactactactactggagctactact
aacatactgacagagtcacagaagccaaatcttataatgtcagagacagagactttcaag
acaggacaggttcctggtagtccaggggtaggaggaggagggtgggatgatatcagagag
ttggataacgccgagaattggacagagaggacacgagttatatcaaagcaggatcatcag
ttttactcgcagtgtgcacaaggttttgtttcagagcttgttgacaagctaccggataaa
agtacaaaagaagactataatgattatggtattactggcgacaatgaagtacctaattca
agatctccttcaaatccttcagcaacaacaacgggaggaggaggtgattttggttatatg
gatcagtttgatgatcgcgattttcaattatcagcttctcagtttaacactgattatttt
gagaggatgggctctaatactaatacaactaccagtgccctagccagagagtccttatat
gttaagtttgatccgttagtaggtccagtggtaccagcacgtactactcctcctctccct
ccccccatgagcggcgataatcttctcatgcttaacacacccccaacggcaacttttacg
aaatcatcagtgattggttcggaagccacgccccaaacagggacacgggacttgatgcag
agcccgaacttgttacacatgactggagggaacaatgataatatgagaatgtctcctttt
gcatcacagagtccgttccccaagacactattagacacttcctcctctccatcttctaac
tacctcattggtcagtccccttcagctaatcccaatataagtggacctggtcttcactta
ccaccggcacgctcatctcttgagggtaatccagaactagtcaaggtgttaaaatatact
gattatgacttgcagaggattattgctcaagtcaggcaagaagcacaggcagaaattgag
agccaagttcttgctgtgagagaagaatattcacaggagttccaaaaatcacagaaaaag
atggacaggctggtcaaagaacttcaaaatttgaggtcaaacaatgcactccagacatca
agcaactctaaaatggaagaagagtgctcgaaattgaaagccctgtgtgatgaacatctt
gccactgaaaagaagatgcttgacatgtatgagaaactaaaggaagagagcagacagata
gagcagcaaagagatcaggctcttgctgatttcaattccatggagaagtcgtttgcagat
tttcaccaaagacacataaaagcacgcgagactttgacattattacagaaatctgagagc
tcattacaagaccatattgctcacctggagaagaaagttgaatcattagaagaaatgaat
cagcagctgcaagatgaaacattcctaaaaatacaagaggccaataagatatacgataag
ctacagtctgatcatgcatcagagctagcagtgacaaaagcaaatgttaaaaagatgaca
gttcaaatatcaagccttgaagggcaactgaaacaaaaggaacaagagaagcaagagttg
actcttatatgtgatgagctaatgaaggaactgggaagcaagtga

DBGET integrated database retrieval system