KEGG   Amphimedon queenslandica (sponge): 100636198Help
Entry
100636198         CDS       T02284                                 

Definition
(RefSeq) dual specificity tyrosine-phosphorylation-regulated kinase 1B-like
  KO
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100636198
Protein kinases [BR:aqu01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100636198
Membrane trafficking [BR:aqu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    100636198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Unknown
AA seq 702 aa AA seqDB search
MAHYYHTRSGVYHKRSQDVMDGSSSDSSLQQHHSHSSSDPRQQHVSVVKKLTVDLIKTYR
TINEVYYKKRRISDRTDQSNGAGASSSRRSIKSEQYDDENHDYKVKPGERWLDRYEIDSL
IGKGSFGQVVKAFDLEEREWVAIKVIKNKRAFYQQALIEKRLLELLNSRDPEGKYYIVSL
KRSFTFRGHLCFVFELLSYNLYELLRNTNFRGVSLNLTRKFAQQLCTALLFLSTHDINVI
HCDLKPENILLCNPKRSAIRIVDFGSSCQVGSRMFQYIQSRFYRSPEVLLGIPYDLAIDM
WSLGCILVEMHTGEPLFSGKDEIDQMSKIVEVLGIPPPHVLERSARRDRFFERESGGTWV
LKRQRDGRKDHHRRPGSRSLYEILGGDKGGPGGLRKGDSGHTPNDYYKFRDLVLQMLDYD
PETRIKPLAALKHPFFRKEARLSQSSENGSQYSSTTPTQTIGLTSSSSQPIDSFVISQEI
VAMETNHTHPPPGLGELIPGRHIHLQNLSPPETHDTSLYGGNNGRGVVGSSGTLGSGTFS
NSGSFGSAMDIGQPQQPVAMTMEASSSLHQVTGSHRPHSGRKGEGGERKRGPSPNASLHN
GGGVQVFYGTNSLFPQSSDSNFSFQMSPSSSSKGGGAHVPHHVTEREGVRTRSGAGSNSR
NQKSYRHHHHHHHHRRTHPSEGGASGSHDDQGGSMVGVTVHQ
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggctcattattaccacactagatctggtgtctatcataaaagaagccaagatgttatg
gatggcagtagcagcgactcttcactgcaacagcatcattctcattcttcctctgatcca
agacaacaacatgtctctgttgtaaagaaactaactgtggacctcattaagacttatagg
actatcaacgaggtttattataaaaagaggcgtatttctgacagaactgatcagtcaaac
ggggcaggtgctagttctagtcgaaggtccattaaatctgagcagtacgatgatgagaat
cacgactataaagtaaagccaggagaaagatggctggacagatatgaaatagactcactt
attggtaaaggatcttttggacaggtcgttaaagcttttgatctagaagagagagagtgg
gtagccattaaagtaataaagaacaagagagcgttttaccagcaggccctgatagagaaa
agattactggagctactaaacagcagggaccccgaggggaaatattatatagtttccctc
aaaagatctttcactttcagaggccatctttgttttgttttcgaacttctctcctacaat
ctctatgaattattgcgcaatactaacttcaggggcgtgtcactcaatctgactcggaag
tttgctcagcagctgtgcactgccctcctctttctctcgactcatgatatcaacgtgatt
cattgtgatcttaaacctgagaatatcctcctctgcaatcctaagagaagtgccattagg
atcgtggactttggtagctcttgtcaagtcggaagcagaatgttccagtacattcagagt
cggttctatagatcccctgaggtcctgttagggataccctatgacctagctatagacatg
tggagtttaggttgtatattagttgagatgcacactggggagcctctcttcagtgggaag
gatgagattgatcagatgagtaagattgttgaggtcctcggtattcctcctcctcacgta
ctggagcgctcagcaagacgggacaggttctttgaacgagagtctggaggtacctgggta
ctgaagagacagagggacggccgaaaagatcaccacaggcgtcctggcagtcgttcctta
tacgaaatactgggaggggacaagggaggaccaggggggctgaggaaaggagactctggc
cacacccccaatgactattataagtttcgtgatctagtcctccaaatgttggactatgac
cctgagactcggataaaacctctcgctgctcttaagcacccgttcttccgtaaagaagct
cgtttatcccaatcctctgaaaatggcagtcaatattcatcgaccacacccacccagact
atcggactgacctcctcatcctctcaaccaatagactccttcgtcatatcacaggagata
gttgccatggaaacaaaccacacccacccacccccagggctgggagagctgataccaggc
cgacacattcaccttcaaaacctctcacctccagagactcacgacacttccttatatgga
ggtaataacggcagaggtgtcgttgggtctagcggtacactgggcagtggtacttttagt
aacagtgggtcgtttgggtcagctatggacattggtcaaccacagcaaccagtagccatg
acaatggaggctagctcatctcttcatcaggtaacgggtagccatagacctcactcaggg
aggaaaggggaaggaggagagagaaagcgaggtccctctcctaatgcgtcactccataat
ggaggaggagttcaagtgttttatggaactaactctctcttccctcaatcctctgatagt
aacttctcctttcaaatgagtccctcctcctcctctaaagggggaggggctcatgttcct
catcatgtgaccgagagggagggtgttcgtaccaggagtggagctgggtctaatagcagg
aaccaaaagtcttatagacaccatcatcatcatcatcaccatcggaggacacacccctca
gagggaggggctagtggtagtcatgatgaccagggaggatctatggttggtgtgacagta
catcagtga

DBGET integrated database retrieval system