KEGG   Amphimedon queenslandica (sponge): 100636198Help
Entry
100636198         CDS       T02284                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase 1A-like
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
aqu  Amphimedon queenslandica (sponge)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 683 aa AA seqDB search
MDGSSSDSSLQQHHSHSSSDPRQQHVSVVKKLTVDLIKTYRTINEVYYKKRRISDRTDQS
NGAGASSSRRSIKSEQYDDENHDYKVKPGERWLDRYEIDSLIGKGSFGQVVKAFDLEERE
WVAIKVIKNKRAFYQQALIEKRLLELLNSRDPEGKYYIVSLKRSFTFRGHLCFVFELLSY
NLYELLRNTNFRGVSLNLTRKFAQQLCTALLFLSTHDINVIHCDLKPENILLCNPKRSAI
RIVDFGSSCQVGSRMFQYIQSRFYRSPEVLLGIPYDLAIDMWSLGCILVEMHTGEPLFSG
KDEIDQMSKIVEVLGIPPPHVLERSARRDRFFERESGGTWVLKRQRDGRKDHHRRPGSRS
LYEILGGDKGGPGGLRKGDSGHTPNDYYKFRDLVLQMLDYDPETRIKPLAALKHPFFRKE
ARLSQSSENGSQYSSTTPTQTIGLTSSSSQPIDSFVISQEIVAMETNHTHPPPGLGELIP
GRHIHLQNLSPPETHDTSLYGGNNGRGVVGSSGTLGSGTFSNSGSFGSAMDIGQPQQPVA
MTMEASSSLHQVTGSHRPHSGRKGEGGERKRGPSPNASLHNGGGVQVFYGTNSLFPQSSD
SNFSFQMSPSSSSKGGGAHVPHHVTEREGVRTRSGAGSNSRNQKSYRHHHHHHHHRRTHP
SEGGASGSHDDQGGSMVGVTVHQ
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggatggcagtagcagcgactcttcactgcaacagcatcattctcattcttcctctgat
ccaagacaacaacatgtctctgttgtaaagaaactaactgtggacctcattaagacttat
aggactatcaacgaggtttattataaaaagaggcgtatttctgacagaactgatcagtca
aacggggcaggtgctagttctagtcgaaggtccattaaatctgagcagtacgatgatgag
aatcacgactataaagtaaagccaggagaaagatggctggacagatatgaaatagactca
cttattggtaaaggatcttttggacaggtcgttaaagcttttgatctagaagagagagag
tgggtagccattaaagtaataaagaacaagagagcgttttaccagcaggccctgatagag
aaaagattactggagctactaaacagcagggaccccgaggggaaatattatatagtttcc
ctcaaaagatctttcactttcagaggccatctttgttttgttttcgaacttctctcctac
aatctctatgaattattgcgcaatactaacttcaggggcgtgtcactcaatctgactcgg
aagtttgctcagcagctgtgcactgccctcctctttctctcgactcatgatatcaacgtg
attcattgtgatcttaaacctgagaatatcctcctctgcaatcctaagagaagtgccatt
aggatcgtggactttggtagctcttgtcaagtcggaagcagaatgttccagtacattcag
agtcggttctatagatcccctgaggtcctgttagggataccctatgacctagctatagac
atgtggagtttaggttgtatattagttgagatgcacactggggagcctctcttcagtggg
aaggatgagattgatcagatgagtaagattgttgaggtcctcggtattcctcctcctcac
gtactggagcgctcagcaagacgggacaggttctttgaacgagagtctggaggtacctgg
gtactgaagagacagagggacggccgaaaagatcaccacaggcgtcctggcagtcgttcc
ttatacgaaatactgggaggggacaagggaggaccaggggggctgaggaaaggagactct
ggccacacccccaatgactattataagtttcgtgatctagtcctccaaatgttggactat
gaccctgagactcggataaaacctctcgctgctcttaagcacccgttcttccgtaaagaa
gctcgtttatcccaatcctctgaaaatggcagtcaatattcatcgaccacacccacccag
actatcggactgacctcctcatcctctcaaccaatagactccttcgtcatatcacaggag
atagttgccatggaaacaaaccacacccacccacccccagggctgggagagctgatacca
ggccgacacattcaccttcaaaacctctcacctccagagactcacgacacttccttatat
ggaggtaataacggcagaggtgtcgttgggtctagcggtacactgggcagtggtactttt
agtaacagtgggtcgtttgggtcagctatggacattggtcaaccacagcaaccagtagcc
atgacaatggaggctagctcatctcttcatcaggtaacgggtagccatagacctcactca
gggaggaaaggggaaggaggagagagaaagcgaggtccctctcctaatgcgtcactccat
aatggaggaggagttcaagtgttttatggaactaactctctcttccctcaatcctctgat
agtaacttctcctttcaaatgagtccctcctcctcctctaaagggggaggggctcatgtt
cctcatcatgtgaccgagagggagggtgttcgtaccaggagtggagctgggtctaatagc
aggaaccaaaagtcttatagacaccatcatcatcatcatcaccatcggaggacacacccc
tcagagggaggggctagtggtagtcatgatgaccagggaggatctatggttggtgtgaca
gtacatcagtga

DBGET integrated database retrieval system