KEGG   Amphimedon queenslandica (sponge): 100636234Help
Entry
100636234         CDS       T02284                                 

Definition
(RefSeq) stress-activated protein kinase JNK-like
  KO
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100636234
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100636234
   04068 FoxO signaling pathway
    100636234
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100636234
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100636234
Protein kinases [BR:aqu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100636234
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 365 aa AA seqDB search
MADFYTTQVGDTLFTIPRRYQDLKPLGHGAQGVVCSAKDSVRGERIAIKKLVKPFQNETY
AKRAFRELKLMKMVNHKNVIGLLNLFSPAHSIEDFEDVYIVMELMDANLCRVIGIELDHD
RMSYLLYQLLCGIKHLHSAGIIHRDLKPSNIVVKEDCSLKILDFGLARAADKAFMMTPYV
VTRYYRAPEVIVGMKYKENVDIWSVGCIFAEIVRGDILLPGRDYIDQWNKVTQILGTPPQ
EFFKQLQPSVRMYCESQPRHKGKSWNELFPDDVFPNDSKEDAHKTRLAVDLLTKMLQIEP
TRRVTVDEALKHPYVSIWYDPSEADAPPPPKYDHCLDEKNIPLAQWKKLIYEEVISFDER
RDAKR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggctgacttctacaccacgcaagtaggtgacacgctcttcacgataccacggagatac
caggacctgaaaccattaggacacggggctcaaggagtcgtatgttctgctaaagattct
gttagaggagagaggatagccatcaagaagcttgtaaaacctttccagaacgagacttat
gccaagagagcgtttagggaactgaaactgatgaagatggtgaaccacaagaatgtcatc
ggtttgttgaatctctttagcccggctcattctattgaggattttgaggatgtttatatt
gtgatggagctaatggatgctaacctctgtagagtcattggcatagaattagaccatgac
agaatgtcatacctcctctatcagctgctgtgtggcatcaagcatttgcattcagctgga
atcattcacagagatttaaagcctagtaacattgtagtgaaggaggattgctcattaaag
atccttgactttggtttagccagagctgccgacaaagcctttatgatgaccccatacgtc
gtcactaggtactacagggcacctgaagtaattgttggcatgaaatataaagaaaacgtt
gacatttggtctgttggttgtatctttgctgagattgtcagaggtgacatactgctccca
gggagagactatattgaccaatggaacaaagtgactcaaatacttggaactcctcctcaa
gaattcttcaaacagctccaaccatcagtcagaatgtattgtgaaagtcaaccaaggcac
aagggaaagtcttggaatgagctgtttcctgatgatgtctttcctaacgattccaaggaa
gatgcacataaaactcggcttgctgtggatttgttaacaaagatgctgcagatagagcca
acaaggcgagtgactgtagacgaagcgctgaagcatccttatgtatctatttggtacgat
ccttctgaagctgatgctcctcctcctcctaaatatgatcactgcttggatgagaaaaac
attccactggcccagtggaagaagctcatttacgaagaagtgataagttttgacgagcga
agagatgcgaaacgctaa

DBGET integrated database retrieval system