KEGG   Amphimedon queenslandica (sponge): 100636234Help
Entry
100636234         CDS       T02284                                 

Definition
stress-activated protein kinase JNK-like
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100636234
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100636234
   04068 FoxO signaling pathway
    100636234
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100636234
Protein kinases [BR:aqu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100636234
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 365 aa AA seqDB search
MADFYTTQVGDTLFTIPRRYQDLKPLGHGAQGVVCSAKDSVRGERIAIKKLVKPFQNETY
AKRAFRELKLMKMVNHKNVIGLLNLFSPAHSIEDFEDVYIVMELMDANLCRVIGIELDHD
RMSYLLYQLLCGIKHLHSAGIIHRDLKPSNIVVKEDCSLKILDFGLARAADKAFMMTPYV
VTRYYRAPEVIVGMKYKENVDIWSVGCIFAEIVRGDILLPGRDYIDQWNKVTQILGTPPQ
EFFKQLQPSVRMYCESQPRHKGKSWNELFPDDVFPNDSKEDAHKTRLAVDLLTKMLQIEP
TRRVTVDEALKHPYVSIWYDPSEADAPPPPKYDHCLDEKNIPLAQWKKLIYEEVISFDER
RDAKR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggctgacttctacaccacgcaagtaggtgacacgctcttcacgataccacggagatac
caggacctgaaaccattaggacacggggctcaaggagtcgtatgttctgctaaagattct
gttagaggagagaggatagccatcaagaagcttgtaaaacctttccagaacgagacttat
gccaagagagcgtttagggaactgaaactgatgaagatggtgaaccacaagaatgtcatc
ggtttgttgaatctctttagcccggctcattctattgaggattttgaggatgtttatatt
gtgatggagctaatggatgctaacctctgtagagtcattggcatagaattagaccatgac
agaatgtcatacctcctctatcagctgctgtgtggcatcaagcatttgcattcagctgga
atcattcacagagatttaaagcctagtaacattgtagtgaaggaggattgctcattaaag
atccttgactttggtttagccagagctgccgacaaagcctttatgatgaccccatacgtc
gtcactaggtactacagggcacctgaagtaattgttggcatgaaatataaagaaaacgtt
gacatttggtctgttggttgtatctttgctgagattgtcagaggtgacatactgctccca
gggagagactatattgaccaatggaacaaagtgactcaaatacttggaactcctcctcaa
gaattcttcaaacagctccaaccatcagtcagaatgtattgtgaaagtcaaccaaggcac
aagggaaagtcttggaatgagctgtttcctgatgatgtctttcctaacgattccaaggaa
gatgcacataaaactcggcttgctgtggatttgttaacaaagatgctgcagatagagcca
acaaggcgagtgactgtagacgaagcgctgaagcatccttatgtatctatttggtacgat
ccttctgaagctgatgctcctcctcctcctaaatatgatcactgcttggatgagaaaaac
attccactggcccagtggaagaagctcatttacgaagaagtgataagttttgacgagcga
agagatgcgaaacgctaa

DBGET integrated database retrieval system