KEGG   Amphimedon queenslandica (sponge): 100636239Help
Entry
100636239         CDS       T02284                                 

Definition
(RefSeq) cGMP-dependent protein kinase 1
  KO
K07376  
cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
aqu  Amphimedon queenslandica (sponge)
Module
cGMP signaling
Brite
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100636239
Protein kinases [BR:aqu01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100636239
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 712 aa AA seqDB search
MSANNEQKLRDLLLQRAMELQKFKSDLERVTKINKEQQNEIAAKNEQISTLEGELKKKQK
ELEIQKQRVTELTEIMDRQVRDKSRPVEHRQGISAEPTKALKITQLPRYEKDQRSKELIF
RAITANDFLKNLEKVQTTEIVECMFPLDFKQDQFICREGAVGTELYVIAEGEVQVTKGGQ
VRTEMGPGKLFGELAILYNCTRTATIKAKVDTKVWALDRSCFQTIMMNHGIIRQSEYLSF
LRSVPELRMLNERDLMKLADVLQEDFYPQGEYIIRQRQTGETFFIISDGTVKITKQASPD
APEETIRELGRGDYFGEKALLGDKYRTASVIATSNVCCLCVDRDHFTQLIGNLVERTYKD
SEEKKLEGVLIEDEDTKEYSMMTLDDLVRVETLGMGGFGRVELVQLKTDSTRTFALKCLR
KKHIVDTRQQEHIFSEKSIMLSGRSPFITRLYKTFRCPKYLYMLLEVCLGGELWTILRDR
GSFDDATTRFCTACVVEAFQYLHSREIVYRDLKPENLLLDNAGYVKLVDFGFAKYIGPGR
KTWTFCGTPEYVAPEIILNKGHDLSADYWSLGILMYELLTGSPPFSGADPMRTYNIILKG
IDVVDFPKKITRSAQNLIKKLCRDNPAERLGYLRNGLNDIKGHRWFQGFDWEGLKKRVVV
PPIVPNVRGATDTSNFDHFPASQEDIPPDDLSGWDKDFGEIQRTPAWCLRGY
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccaacaatgagcaaaagctgagggacttgctccttcaaagagcaatggaacta
caaaagttcaagtcggacctggaaagagtaacaaaaataaacaaagagcaacaaaatgag
atagctgctaagaatgaacagatcagtacactggaaggggaacttaagaagaagcagaag
gaacttgagattcagaagcaacgtgtgactgaattaacagaaatcatggaccgtcaagta
cgagataagagcaggcctgttgaacacagacaaggtatatctgctgagcccactaaagca
cttaagattacccaactcccacgctatgagaaagaccaaaggtcaaaggaactcattttt
cgtgctattacagctaatgactttttgaagaatttggagaaagtgcagacaactgaaatt
gttgagtgcatgtttcctcttgacttcaagcaagatcagtttatttgtcgtgaaggagct
gtggggactgagctatatgtcattgcagagggagaagttcaagtgactaagggtggtcaa
gtcaggactgaaatgggcccaggaaagctttttggagagttagcaattttgtacaactgt
acaaggactgctaccattaaagcaaaagttgacacaaaggtatgggccttggaccgaagt
tgctttcaaaccatcatgatgaatcatggtattattcgtcagtcagaatatcttagcttc
cttagaagtgttcctgaattgaggatgctgaatgagagagatttgatgaaactggctgat
gtccttcaagaggacttttatcctcaaggtgaatacattatacgtcagagacaaacagga
gaaacattctttattattagtgatggaacagttaagatcactaaacaagcttcacctgat
gcgcctgaagaaactattagggaattagggcgtggagactattttggagaaaaggcatta
ttgggggataaataccgtacagctagtgttattgctaccagcaacgtttgttgtctttgt
gttgatagagatcactttactcaactgattggaaatctggtggagcgaacatacaaagat
agtgaagagaagaagcttgagggtgtgttgattgaagatgaagatactaaggaatattca
atgatgactcttgatgatcttgttagagtagagactcttgggatgggtggatttggaaga
gtggaattggttcaactgaagactgatagcactcgtacttttgctttgaagtgccttcgt
aagaagcacattgttgacacacgacagcaagagcacatcttttcagagaagtctatcatg
ttgtccggccgttctccattcataacaaggctgtataaaacattccgctgtcctaagtat
ctctacatgttgcttgaagtttgtcttggaggggaactctggactattctgagggacagg
ggaagctttgatgatgctacaacaaggttctgtactgcatgtgttgttgaggcattccaa
tatttacactcaagggagattgtctaccgtgatctcaaaccagagaatctgttgcttgat
aatgctggctatgttaaattggttgactttggttttgccaagtatattggtcctgggcgt
aagacatggactttttgtggaacacctgagtatgttgcccccgagatcattctgaacaaa
ggtcatgatttgtctgctgattattggtcccttgggatattgatgtatgagttgttaaca
ggaagtcctcctttctctggtgctgatccaatgcgtacatacaatatcattctgaagggt
attgatgtggttgattttcctaagaaaatcacccgcagtgctcagaacctcattaagaaa
ctgtgcagggacaaccctgcagagcgtctgggttacttaagaaatggtcttaatgatatt
aaaggccacaggtggtttcaaggatttgattgggaaggattgaagaagagggttgttgtg
ccaccaattgttccaaatgttaggggagctaccgacacatccaactttgaccatttccca
gctagtcaagaagacatacctcctgatgacctctctggttgggataaagactttggagag
atccagcgtacaccagcctggtgtcttcgtggatactaa

DBGET integrated database retrieval system