KEGG   Amphimedon queenslandica (sponge): 100636239Help
Entry
100636239         CDS       T02284                                 

Gene name
Prkg1
Definition
protein kinase, cGMP-dependent, type I
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
aqu  Amphimedon queenslandica (sponge)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 714 aa AA seqDB search
MSANNEQKLRDLLLQRAMELQKFKSDLERVTKINKEQQNEIAAKNEQISTLEGELKKKQK
ELEIQKQRVTELTEIMDRQVRDKSRPVEHRQGISAEPTKALKITQLPRYEKDQRSKELIF
RAITANDFLKNLEKVQTTEIVECMFPLDFKQDQFICREGAVGTELYVIAEGEVQVTKGGQ
VRTEMGPGKLFGELAILYNCTRTATIKAKVDTKVWALDRSCFQTIMMNHGIIRQSEYLSF
LRSVPELRMLNERDLMKLADVLQEDFYPQGEYIIRQRQTGETFFIISDGTVKITKQASPD
APEETIRELGRGDYFGEKALLGDKYRTASVIATSNVCCLCVDRDHFTQLIGNLVERTYKD
SEEKKLEGYVVLIEDEDTKEYSMMTLDDLVRVETLGMGGFGRVELVQLKTDSTRTFALKC
LRKKHIVDTRQQEHIFSEKSIMLSGRSPFITRLYKTFRCPKYLYMLLEVCLGGELWTILR
DRGSFDDATTRFCTACVVEAFQYLHSREIVYRDLKPENLLLDNAGYVKLVDFGFAKYIGP
GRKTWTFCGTPEYVAPEIILNKGHDLSADYWSLGILMYELLTGSPPFSGADPMRTYNIIL
KGIDVVDFPKKITRSAQNLIKKLCRDNPAERLGYLRNGLNDIKGHRWFQGFDWEGLKKRV
VVPPIVPNVRGATDTSNFDHFPASQEDIPPDDLSGWDKDFGEIQRTPAWCLRGY
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccaacaatgagcaaaagctgagggacttgctccttcaaagagcaatggaacta
caaaagttcaagtcggacctggaaagagtaacaaaaataaacaaagagcaacaaaatgag
atagctgctaagaatgaacagatcagtacactggaaggggaacttaagaagaagcagaag
gaacttgagattcagaagcaacgtgtgactgaattaacagaaatcatggaccgtcaagta
cgagataagagcaggcctgttgaacacagacaaggtatatctgctgagcccactaaagca
cttaagattacccaactcccacgctatgagaaagaccaaaggtcaaaggaactcattttt
cgtgctattacagctaatgactttttgaagaatttggagaaagtgcagacaactgaaatt
gttgagtgcatgtttcctcttgacttcaagcaagatcagtttatttgtcgtgaaggagct
gtggggactgagctatatgtcattgcagagggagaagttcaagtgactaagggtggtcaa
gtcaggactgaaatgggcccaggaaagctttttggagagttagcaattttgtacaactgt
acaaggactgctaccattaaagcaaaagttgacacaaaggtatgggccttggaccgaagt
tgctttcaaaccatcatgatgaatcatggtattattcgtcagtcagaatatcttagcttc
cttagaagtgttcctgaattgaggatgctgaatgagagagatttgatgaaactggctgat
gtccttcaagaggacttttatcctcaaggtgaatacattatacgtcagagacaaacagga
gaaacattctttattattagtgatggaacagttaagatcactaaacaagcttcacctgat
gcgcctgaagaaactattagggaattagggcgtggagactattttggagaaaaggcatta
ttgggggataaataccgtacagctagtgttattgctaccagcaacgtttgttgtctttgt
gttgatagagatcactttactcaactgattggaaatctggtggagcgaacatacaaagat
agtgaagagaagaagcttgaggggtatgttgtgttgattgaagatgaagatactaaggaa
tattcaatgatgactcttgatgatcttgttagagtagagactcttgggatgggtggattt
ggaagagtggaattggttcaactgaagactgatagcactcgtacttttgctttgaagtgc
cttcgtaagaagcacattgttgacacacgacagcaagagcacatcttttcagagaagtct
atcatgttgtccggccgttctccattcataacaaggctgtataaaacattccgctgtcct
aagtatctctacatgttgcttgaagtttgtcttggaggggaactctggactattctgagg
gacaggggaagctttgatgatgctacaacaaggttctgtactgcatgtgttgttgaggca
ttccaatatttacactcaagggagattgtctaccgtgatctcaaaccagagaatctgttg
cttgataatgctggctatgttaaattggttgactttggttttgccaagtatattggtcct
gggcgtaagacatggactttttgtggaacacctgagtatgttgcccccgagatcattctg
aacaaaggtcatgatttgtctgctgattattggtcccttgggatattgatgtatgagttg
ttaacaggaagtcctcctttctctggtgctgatccaatgcgtacatacaatatcattctg
aagggtattgatgtggttgattttcctaagaaaatcacccgcagtgctcagaacctcatt
aagaaactgtgcagggacaaccctgcagagcgtctgggttacttaagaaatggtcttaat
gatattaaaggccacaggtggtttcaaggatttgattgggaaggattgaagaagagggtt
gttgtgccaccaattgttccaaatgttaggggagctaccgacacatccaactttgaccat
ttcccagctagtcaagaagacatacctcctgatgacctctctggttgggataaagacttt
ggagagatccagcgtacaccagcctggtgtcttcgtggatactaa

DBGET integrated database retrieval system