KEGG   Amphimedon queenslandica (sponge): 100636359Help
Entry
100636359         CDS       T02284                                 

Definition
aldehyde dehydrogenase family 1 member L1-like
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    100636359
Enzymes [BR:aqu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     100636359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 622 aa AA seqDB search
MSFVLSLARFSATVAARSCLQSPRLFSTSPSLAKELRIAIIGQSVFGQEVYSLLRRQGKN
VVGVFTVPDNNCRPDPLAAQAEKDGTPVFKIPRWRLKGQLLPDVYEKYKSVKATLNVLPF
CTQFIPMEVIDGAEEGSIIYHPSILPKHRGASAINWTLMEGDSTAGFTIFWADDGLDTGP
ILLQRSCTVDINDTVDTLYNRFLFPEGIRAMGEAVKLIEDGKAPRIVQWEGGATYDQLWQ
KKDVAKINWNTTALELHNFIRGSDKVPGAWTMIDKQKVTLYGSVFVDDREPVTGREIEIE
GLAQPAVITQNGLVMYGSDGKKIRVTQLQLEDGRMIPANKWGREEKVEKLELSPEEEALQ
EKLRGIWSSILSLSIVEDQTDFFAAGASSMDVTRLIEEVKDLCDVSMDNDNVYMSPKFTE
FVTEVVIRSRGGGQASKFEYEPVTIEANGRTLQFPNQLFVNGEFINSSWGKDYDCVNPTD
ETVICKVESASVDDVNTAVKAAKYAFEEGEWGKMNARDRGALMYKLADLMEEHKEELATL
ESLDSGAVYTLALKTHIGFSIDSLRYFASWCDKIQGKTIPINHARPSRNLSISKREPIGV
CGIVIPWNYPLMIIGKWKLVLI
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgttctgtctcttgctagattctctgctactgttgctgctagatcatgcctg
cagtcacccagactcttttcaacgagtccttctctcgctaaagagctccgtatagctatc
ataggccagtctgtgtttggtcaagaggtgtacagtctgttgaggagacagggaaagaat
gttgttggtgtgtttacggtaccagacaacaattgtagacctgacccactggcagctcaa
gctgagaaagatggaactcctgtatttaagataccaagatggagattgaaaggtcaatta
ctacctgatgtgtatgagaagtataaaagtgtaaaagctactcttaacgtgctaccattc
tgtactcagttcatacctatggaagtcattgatggagcagaggagggatccattatatat
catccgtctattctaccgaaacatagaggagcatcagctattaactggacactaatggaa
ggtgattctacagctggattcactatcttctgggcagacgatggccttgacactggacca
atcttacttcagagatcttgtactgttgatataaatgatacggtagacacactgtataat
aggttcctttttcctgaaggcattagagccatgggtgaagcagttaaactcattgaagat
ggtaaagctccacgtattgtccaatgggaagggggtgccacgtatgatcaattgtggcag
aaaaaggatgttgccaagattaactggaatacaacagcacttgaactgcataattttatt
cgtggatccgacaaagtccctggtgcatggaccatgattgacaaacaaaaagtgacactg
tatggttcagtgtttgttgatgacagagagccagttactggtagagagattgagatagaa
ggattagctcaaccagctgtcataacacagaatggtttagtgatgtatggatctgatgga
aagaaaataagagtaacacaacttcagttggaagatggtcgtatgatacctgccaataaa
tgggggagagaagagaaagtggagaaattagaattgagtcctgaagaagaagcattacaa
gagaaattgaggggtatatggtctagtatactcagcctttctatagtagaggatcagaca
gatttctttgcagcaggtgcttcatcaatggatgtcacaaggttaattgaagaagtaaaa
gacctctgtgatgtgtcgatggataatgataatgtttatatgagtccaaagtttactgag
tttgtgactgaagttgtaattaggagcagaggaggtggccaagcgtctaagtttgagtat
gagccagtaactattgaagctaatggaaggacactacaatttcccaaccagttgtttgtt
aatggagagtttatcaactcatcatggggaaaggattatgattgtgttaatcctactgat
gaaacagtcatttgtaaagttgagtctgcttctgtagatgatgttaacacagcagtcaaa
gcagctaaatatgcatttgaagaaggagaatggggtaagatgaatgctcgtgatagaggt
gcactgatgtacaaattagctgatttaatggaagagcataaagaagaattggccacatta
gagagcttagattcaggagctgtgtatacattagccctcaagactcacattggattctct
attgatagtcttcgttactttgctagctggtgtgacaagattcagggtaaaaccatacca
attaatcatgcaagacctagcaggaacctttcaatatctaaaagggaacctattggtgtg
tgtggcattgtgataccttggaattatcctcttatgattattgggaagtggaaactagtc
ctaatatag

DBGET integrated database retrieval system