KEGG   Amphimedon queenslandica (sponge): 100636470Help
Entry
100636470         CDS       T02284                                 

Definition
single-strand selective monofunctional uracil DNA glycosylase-like
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:aqu03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 295 aa AA seqDB search
MAVSKVCKQSDILKTSATEDEESLEHRHKRRETEIPSTGTHSDNICDDILTIERIQCELL
LQLDYSSSHVTHVYNPIDYASEPHCYYVRQYGNGKKQVLFIGMNPGPFGMAQNGVPFGDV
TQVKEWLGVKGQVFKPENENPNRPVKGLSITRNEVSGTRFWSLMKSIAGTPKAFFSICYV
HNYCPLCFMTASGKNVTPPSLKVRERKQLESICDKSLTDFILLSNVRYIVCVGKYVETRA
KLIAKDFTSWKIEIGSITHPSPINPSANRGDWVAMATQQLREMNVLPVMINENHI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggcagttagtaaagtttgtaaacaaagtgatattttaaaaacctctgctactgaagac
gaggaatcactggaacacaggcataaaaggagagagacagaaatacccagtactggcacc
cactctgataatatctgtgatgatatactaacaattgagagaatccaatgtgaactgtta
ctacagctggattattcctctagtcacgtgactcatgtatataatccaatagactatgcc
tcagagcctcactgttattatgtaagacagtacggtaatggaaagaaacaagttctattt
attggaatgaatccagggcctttcggaatggcacaaaatggagtaccatttggtgatgta
actcaagtcaaagaatggctaggggtcaaaggtcaagtgtttaaaccagaaaacgagaat
cctaatagaccagtaaagggactctccatcactcgtaatgaggtttctggcacaaggttc
tggtctctcatgaaatccattgctgggactccaaaagcgttctttagtatctgttatgtt
cataattactgcccactttgcttcatgacggcctccggtaaaaacgtaactcctccatca
ttgaaagtcagagagagaaaacagcttgaaagtatatgcgataaatcactgactgatttc
atattattgtcaaatgttcggtatattgtctgtgttggtaaatatgtggaaacaagagct
aagctgattgctaaagactttactagttggaagatagagattggttccatcactcatcct
tcacctattaacccatccgctaatagaggagactgggtagctatggccacccaacaatta
agagaaatgaatgtattaccagttatgatcaatgaaaatcatatttaa

DBGET integrated database retrieval system