KEGG   Amphimedon queenslandica (sponge): 100636556Help
Entry
100636556         CDS       T02284                                 

Definition
TNF receptor-associated factor 2-like
Orthology
K03173  
TNF receptor-associated factor 2
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100636556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 519 aa AA seqDB search
MPGYDLKVNGEYARIESLECSSCRLILRDAIQNEEGQRFCKSCWEEAISSGSKAQKLGID
PSEEIHPDIAVRREIYRLPVLCENYENGCEWTGKLQDHEHDHKAICEYKTMRCTLGCGKR
IPLGKLRKHEQEECPFRKIDCRHCRSELLAGDYNDHILNCPNAPYTCGHCHTEMPRSEMD
SHILLNCREQLSCFGCDQQIHRSLAKHPNPINHLERDQLFVHLQMLGLAIKKTQTQLNVE
LKEIRKELKEFTESTSIFRDNMIDESSSLTKQVKKLEERLKGEPSNQIILELQESVKLLA
ERVSKVESGASYRPLNQGFDDMSTSDSKMGGSVEHKLAEQERTSGMLKVHLSELELQLQA
SLASTYNGSFLWRIPDVKRRKRDAIEGKITSIYSPPFYTGRNGYKMCIRAYLNGDGIGYN
THLSIFFVLMKGEYDPLLKWPFDYKVSLIMVDQDHKRHIVQTFKPSPSSSSFQRPKSDMN
IASGCPKFAELKILDNESYVKEDVMYVKAIVDTTRIFHP
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgccgggctacgacttaaaggttaatggtgaatacgcccggatcgagtccctcgagtgc
tcctcatgcagactgatactgagagacgctatacaaaatgaagagggtcagaggttttgt
aagagctgctgggaagaagcaatttcctctggttcgaaagctcaaaaattggggattgat
ccatctgaagaaatacaccctgatattgctgttagaagagagatatacaggctcccagtt
ttatgtgagaactatgagaatggatgtgaatggactgggaaacttcaagaccatgagcat
gatcacaaagctatctgtgagtataaaaccatgagatgtactcttggctgtggtaaaaga
atccctcttggaaagttgagaaaacatgaacaagaagagtgtccatttcgaaaaattgat
tgccgacattgcagaagtgaattgttagccggagactataatgatcacatattgaactgt
cctaatgctccttatacttgtggtcattgtcacactgaaatgccaagaagtgaaatggat
agtcacatcttacttaactgcagagaacaactgtcttgctttggatgtgatcagcagata
cacagaagtctagcaaagcatccaaatcctataaatcatttggaacgtgatcaactcttc
gtgcatctccaaatgctaggactggctatcaagaaaacgcagacacaattaaatgtagaa
ctgaaggagattcgaaaagagcttaaagaatttactgaaagcacttcaatattcagggat
aatatgattgatgagagttcctcattaacaaaacaagtaaaaaaactcgaagagcgtctt
aaaggagaaccttcaaaccaaattatactggaattacaagaaagtgttaagctactagct
gaaagagttagtaaggtcgaatctggagcaagctaccgtcctcttaaccagggctttgat
gacatgtcaacaagtgacagcaaaatgggaggatccgtggagcacaaattagcagagcaa
gaaaggacgtctgggatgttaaaagttcatttgtcagagctcgaattacaattacaagct
tctcttgcttctacctacaatggctcatttttgtggcgcatacctgatgtcaaacgaagg
aaaagagatgccattgaggggaaaatcacgtcaatctatagtccacctttctacactgga
cgaaatggatataagatgtgtattcgtgcctatctcaatggagatggaatcggatataat
actcatttatccatttttttcgtcttgatgaaaggtgaatatgacccattattgaagtgg
ccttttgattacaaagtttctttaatcatggtggatcaagaccacaagaggcacattgtg
caaactttcaagccgtctcccagttccagtagcttccagagaccaaaatcagacatgaac
atcgcctctgggtgtccaaagtttgctgagttaaaaatccttgacaatgaatcatacgta
aaagaagatgtaatgtatgttaaggctattgtggacaccactaggattttccatccttaa

DBGET integrated database retrieval system