KEGG   Amphimedon queenslandica (sponge): 100636556Help
Entry
100636556         CDS       T02284                                 

Definition
(RefSeq) TNF receptor-associated factor 2-like
  KO
K03173  
TNF receptor-associated factor 2
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100636556
Messenger RNA biogenesis [BR:aqu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100636556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 464 aa AA seqDB search
MPGYDLKVNGEYARIESLECSSCRLILRDAIQNEEGQRFCKSCWEEAISSGSKAQKLGID
PSEEIHPDIAVRREIYRLPVLCENYENGCEWTGKLQDHEDHILNCPNAPYTCGHCHTEMP
RSEMDSHILLNCREQLSCFGCDQQIHRSLAKHPNPINHLERDQLFVHLQMLGLAIKKTQT
QLNVELKEIRKELKEFTESTSIFRDNMIDESSSLTKQVKKLEERLKGEPSNQIILELQES
VKLLAERVSKVESGASYRPLNQGFDDMSTSDSKMGGSVEHKLAEQERTSGMLKVHLSELE
LQLQASLASTYNGSFLWRIPDVKRRKRDAIEGKITSIYSPPFYTGRNGYKMCIRAYLNGD
GIGYNTHLSIFFVLMKGEYDPLLKWPFDYKVSLIMVDQDHKRHIVQTFKPSPSSSSFQRP
KSDMNIASGCPKFAELKILDNESYVKEDVMYVKAIVDTTRIFHP
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgccgggctacgacttaaaggttaatggtgaatacgcccggatcgagtccctcgagtgc
tcctcatgcagactgatactgagagacgctatacaaaatgaagagggtcagaggttttgt
aagagctgctgggaagaagcaatttcctctggttcgaaagctcaaaaattggggattgat
ccatctgaagaaatacaccctgatattgctgttagaagagagatatacaggctcccagtt
ttatgtgagaactatgagaatggatgtgaatggactgggaaacttcaagaccatgaggat
cacatattgaactgtcctaatgctccttatacttgtggtcattgtcacactgaaatgcca
agaagtgaaatggatagtcacatcttacttaactgcagagaacaactgtcttgctttgga
tgtgatcagcagatacacagaagtctagcaaagcatccaaatcctataaatcatttggaa
cgtgatcaactcttcgtgcatctccaaatgctaggactggctatcaagaaaacgcagaca
caattaaatgtagaactgaaggagattcgaaaagagcttaaagaatttactgaaagcact
tcaatattcagggataatatgattgatgagagttcctcattaacaaaacaagtaaaaaaa
ctcgaagagcgtcttaaaggagaaccttcaaaccaaattatactggaattacaagaaagt
gttaagctactagctgaaagagttagtaaggtcgaatctggagcaagctaccgtcctctt
aaccagggctttgatgacatgtcaacaagtgacagcaaaatgggaggatccgtggagcac
aaattagcagagcaagaaaggacgtctgggatgttaaaagttcatttgtcagagctcgaa
ttacaattacaagcttctcttgcttctacctacaatggctcatttttgtggcgcatacct
gatgtcaaacgaaggaaaagagatgccattgaggggaaaatcacgtcaatctatagtcca
cctttctacactggacgaaatggatataagatgtgtattcgtgcctatctcaatggagat
ggaatcggatataatactcatttatccatttttttcgtcttgatgaaaggtgaatatgac
ccattattgaagtggccttttgattacaaagtttctttaatcatggtggatcaagaccac
aagaggcacattgtgcaaactttcaagccgtctcccagttccagtagcttccagagacca
aaatcagacatgaacatcgcctctgggtgtccaaagtttgctgagttaaaaatccttgac
aatgaatcatacgtaaaagaagatgtaatgtatgttaaggctattgtggacaccactagg
attttccatccttaa

DBGET integrated database retrieval system