KEGG   Amphimedon queenslandica (sponge): 100636574Help
Entry
100636574         CDS       T02284                                 

Definition
ubiquitin carboxyl-terminal hydrolase 30-like
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
aqu  Amphimedon queenslandica (sponge)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 369 aa AA seqDB search
MSGVLQDSTFWWTLCLTGAAAIAATAYVLFGPESLRGRDSRVPGLINLGNTCFINSILQA
MASIPSLLQWLDSKETPLAVSLKNVLHALNDNNEVNISPEELTQALMRHRWLIDHQQQDA
LEFYHVLLTTLEEEMTGPTLSLSDLINDPQVEAQSSSTKGMALTKIGSFSAPSQPKSCPL
QGLMSSSLVCCDCQHALPTRYESIDSISLPLSQRAASSSSLVECLRDYMSSEIVDDIECP
SCSKRAGVKTKRSFRKKLRIGRPPEVLCLNIIRSVWRSDGTMVKNRSRLVFPLTLDINSF
LTTTATRQDKTKYQLRAVVEHLGGPSSGHYCTYRQCGRQWLYTSDTTVYPVYNHEVMNCE
AYLLFYQMD
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcgttttgcaggacagcacgttttggtggactctctgtctaacaggtgcagct
gccatcgcagctacagcttacgttttgtttggtcccgaaagcctcaggggtagagattct
cgtgtaccaggtctcattaatcttggaaacacgtgcttcattaattccattttacaagca
atggcttccataccatccttacttcaatggctggacagtaaagaaaccccactagcagtt
tctcttaagaatgtcttacatgctttaaatgacaataatgaagtgaatatctcgcctgag
gaacttacgcaagctctaatgaggcacagatggttgatcgatcatcagcagcaagatgct
ctggagttttatcatgtcctcctaacaactctggaggaagaaatgacaggccccactttg
tcactctctgatctaatcaatgatcctcaggttgaagcccagagttccagcacaaaaggc
atggctctcactaaaattggttcattcagtgctccttctcaacctaaatcctgtcctttg
caaggcctgatgtccagtagtcttgtctgctgtgactgccagcacgctttgccaactcgg
tatgagtcaatagacagcatctctcttcctcttagtcaaagggcagcctcatcctcatcg
ctagtcgaatgcctcagggactacatgagctctgagatagtggacgacattgagtgtcca
tcttgttccaaaagagccggcgtaaagacaaaaagaagttttcggaagaaactacggatt
gggcgtcctccggaagtactctgccttaatataatccggagtgtttggaggtccgatggc
acgatggtgaagaacaggtccagactggtattccctcttactcttgatatcaatagtttc
ctaactacaacagcaacaagacaagacaaaacgaagtatcaactcagagccgtcgttgaa
catctaggaggaccttcgtcagggcactattgcacgtacaggcaatgcgggagacagtgg
ttgtatacatcggacaccaccgtctatcctgtgtacaatcatgaggttatgaactgtgaa
gcatatcttctcttttatcaaatggattga

DBGET integrated database retrieval system