KEGG   Amphimedon queenslandica (sponge): 100636759Help
Entry
100636759         CDS       T02284                                 

Definition
formamidopyrimidine-DNA glycosylase-like
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:aqu03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 400 aa AA seqDB search
MPELPEVERGRRLAQSVAKGRKLVRVFCKEDPIVFAGTSPRRWRRALEGRRVEAVRRWGK
RIWFVLDAAPHPIFHFGMSGGFDAPGIAPLSLRTSPRSGEGEHRWPPRFLKILLRFDDGG
ELAMFDARRLGSILLREDPENESPIADLGFDPLLAMPRPSEFFRLLQRRRRAIKSLLLDQ
SFAAGVGNWIADEALYQAGIDPRCLASDLIEARSRRLRSKLLAIVRKAVEVDADSERYPR
TWLFHRRWGRNPNASQGKGQGAGGEGRGGIRRHPIACRFGARSGLDVGFAAAIGCRVEGG
IDQQGPRAAVGQSAGQRRSDGPAAGDGDIIMFGGIDGLHRRQGAEIRFRGHGGGVSEGSR
SLVASALDPVSKRDALSAAAAGEKEGSAGGDPPPPAPAAS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattgccggaagtcgaaagagggcggcgccttgcccaaagcgtggcgaagggg
cgcaagctggtgcgcgttttttgcaaggaggatccgatcgtattcgccggcacgagcccc
cgacgctggcggcgagcgcttgagggtcggcgggtggaagcggtgcggcggtggggaaag
cgaatctggttcgtgctcgacgccgctccccatccgatctttcatttcggcatgagcggc
ggtttcgatgccccggggatcgccccgctatcgctgcgcacgagcccccgctccggcgaa
ggcgagcatcgatggccgccgcgctttctcaagatccttttgcgcttcgacgatggcggc
gagttggcgatgttcgacgctcgccgtttgggaagcatcttgctgcgagaagatccggaa
aacgaatccccgatcgccgatctcggtttcgatcccttgctggcgatgcctaggccttca
gaattctttcgcctcttgcagcgtcgtcgccgcgccatcaaaagcctgctcctcgaccaa
tccttcgccgccggcgtcggcaactggatcgccgacgaagccctctatcaggcggggatc
gatccccgctgcttggcatcggatctgatcgaagccagaagccggcgtttgcgaagcaaa
ctcctcgccatcgtccgcaaggcggtcgaagtcgatgccgacagcgaacgctacccccgc
acatggctctttcatcgacgctggggccgcaatccgaatgcgagccaaggaaagggccaa
ggggcggggggtgaaggccgcgggggtatccgaaggcacccgatcgcttgtcgcttcggc
gctcgatccggtctcgatgtcggattcgccgccgccatcggctgccgggtggaaggaggg
atcgaccagcaaggccctcgcgccgctgtcggccagagcgcaggccagcgccgctccgat
ggccccgccgccggcgatggcgacatcataatgttcggcgggatcgacgggcttcatcgt
cggcagggcgcggaaattcgattccggggccacgggggcggggtatccgaaggcagccga
tcgcttgtggcttcggcgctagatccggtctcgaagcgggatgcgctgtcggcagcggct
gccggggagaaggagggatccgccggcggggatcccccgccgccggcgccggcggcatca
taa

DBGET integrated database retrieval system