KEGG   Amphimedon queenslandica (sponge): 100636945Help
Entry
100636945         CDS       T02284                                 

Definition
l-asparaginase-like
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
aqu  Amphimedon queenslandica (sponge)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 607 aa AA seqDB search
MGHTFDTPLARQSALHDTVAVKMSEFLWKKEDLAGSSHSEKKRRVLVLYTGGTIGMKWTE
KGRYSPVKDYFEDKIQTYPMLKDTQYVISSLETERFEGIKPIPLPLTIRNYRILYGIKEY
TPLLDSSNMSMTDWAYIASDIRKYYAKFDAFVILHGTDTMAYTASALSFMLENLGKTIIL
TGSQIPLSELRSDGRDNLLESLIIAGEFVIPEVLLYFNNKLFRGNRTVKMNSSRLDAFSS
PNFPPIARVGVDIKVNWESVFRPSSTEKFHVHSDMNSNVGILRLFPGISKAAICSFLQPP
MEGVVLQSYGAGNIPDSRSDIIQELSAATERGVIIVNCSQCFSGYVSEKYAAGLILRDAN
VIPGYDMTPEASLTKLSYLLSRSELSLEEKRKLMEENLRGEKTVINEQSDPQSLLNDTNL
LRSLTKLLTSNTDVKLLRESLFPSLLCKAASEGDLEALKTLKKEVLNDFIPIGGDVAFPD
YTGLTPLHLAARRGHYDTVHYLLVNGASVHMKDSLHRTPLHEAISFKQLDIIKLLVQTGA
HINETPTEIGSKLCLAASVDDVKLVEAWRLAGADMNSKDYSGNTASSIAQAGSQVSQYLA
KIKCKEN
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgggccacaccttcgacacaccactagctcggcagtcggcactacacgacacagttgca
gtaaaaatgagtgagtttttgtggaagaaggaagacctggctggttctagtcattcagaa
aagaaaaggagagtactagtcttatatactggtggaactattggcatgaagtggacggag
aaaggtaggtattcacctgtgaaggattattttgaagacaagatacagacgtatccaatg
ctcaaagacacccaatacgtcattagtagtctagagacggagagatttgaaggaatcaaa
ccaataccactacctttaaccattcgtaattaccgaatactgtatggtataaaggagtac
actccattgcttgactccagtaacatgtcaatgaccgactgggcatacatagccagtgac
ataaggaaatattatgcaaaatttgatgcctttgtcatcctccatggaacagataccatg
gcatacacggcctctgcactgtcttttatgctagagaacttaggaaagaccatcatattg
acaggatcacagattccattgtcagagttaagaagtgatggaagagacaacctgctcgag
tcactgatcattgctggggagtttgttatacctgaggtcctcctttatttcaataacaag
ttattcaggggaaatagaacggttaaaatgaactcgagtagactcgatgctttctcttct
cctaatttccctcccattgcaagagtcggagtagatataaaagtgaactgggagtcagtg
tttaggccaagcagtactgagaagtttcatgttcattcagacatgaattcaaatgttggg
atacttagactgttccctggaatatcaaaagcagctatctgttcttttctacagccccca
atggagggcgtggtcctccagtcgtatggtgccggtaacattcctgacagtcgttctgat
attattcaagaattatcagctgctaccgagagaggagtcataatagtgaactgcagtcag
tgcttctctggttacgtcagtgagaaatatgcagctggactgatattaagagatgctaat
gtcatacctggatatgatatgactccagaggcttctcttactaaactgtcttacctgctc
agtcggtctgagctctcactagaagagaaacgtaaactaatggaagagaacctaagagga
gagaagacggtcattaacgaacagtccgaccctcagtctttattaaacgataccaattta
ttaagatcgctaacaaaacttctcacttcaaacactgatgtgaagctgttacgtgagtca
ttatttccttctctgctctgtaaagctgcttctgagggtgatctagaagctctgaaaaca
ctcaaaaaagaagtactaaatgattttattcctattggaggtgatgttgcatttccggac
tatactggcctgactccgcttcatttagctgctagacgaggtcattatgacactgttcat
tatttgctcgttaatggagcctcggtacacatgaaggactcactacatcgcactccacta
catgaagctataagttttaagcaactcgatattataaaactcttagtacagactggtgca
cacataaatgagaccccaactgagattggcagcaaactatgcctagctgcttcggtggat
gatgtgaaattggttgaagcttggagactggcaggagctgatatgaactcaaaagattac
tctggaaatacagccagcagtatagctcaagcaggttctcaagtctcacagtatctggct
aaaatcaagtgcaaagaaaactaa

DBGET integrated database retrieval system