KEGG   Amphimedon queenslandica (sponge): 100637497Help
Entry
100637497         CDS       T02284                                 

Definition
4-aminobutyrate aminotransferase, mitochondrial-like
Orthology
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100637497
   00650 Butanoate metabolism
    100637497
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100637497
   00280 Valine, leucine and isoleucine degradation
    100637497
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100637497
Enzymes [BR:aqu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     100637497
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     100637497
Amino acid related enzymes [BR:aqu01007]
 Aminotransferase (transaminase)
  Class III
   100637497
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 491 aa AA seqDB search
MLMLARNISFSYSGSSSLFVRHFSAFQNKGPIIFNKKYLDSLDGGYEAPQVRTSSVPGPK
SLLTANVEIFVDYKASSGNYMVDADGNAFLDVYQQIATLPLGYNNPTLLKASVSDDMMTL
LSSRPSLGYAPSVDYLALLEKSLFSIKPNGMNHSVQLMCGACSVENALKLAFMWYMNNKR
GDRPISQDELDSALKNQSPGCPNITVMSFSNAFHGRTLGCLSLTHSKAINKVDFPLFKGP
IAPFPSLRYPLEEHVRENEAEEKRCLEEVENLMESYEKTSPVAAVIIEPIQGEGGDNHAS
PEFFKGLQKICLKYGSAFIVDEVQTCGGSTGQFWAHESWGLPTPPHLVTFAKKLQSGGVF
AIDGIIPTQPSRIFNTWMGEPSKLLLLSAVLEEMKRENLLSLVRESGHTLLSGLKQLQEL
YPGHISKARGVGTFCAFDAKNRDEMVSKLKVKGINVGPSGRESIRMRPALIFQSKHAEIF
LNALETILKEM
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgttgatgctagcaagaaatatcagtttttcttatagtggtagtagttccttgtttgtc
agacatttctcagcttttcaaaataaagggcccataatatttaacaagaaatatttggac
agtcttgatggtggatatgaagcacctcaagttaggactagcagtgtccctggacctaaa
tcacttttaactgctaatgttgagatatttgttgattacaaggcttcctctggtaattac
atggtcgatgctgatggtaatgcatttcttgatgtttaccaacaaatagcaactctgcca
ctaggatataacaatccaacacttttaaaagcatcagtatcagatgacatgatgaccctc
ctttcatcaagaccttctcttggctatgcgccatctgttgactacctggcactgctagag
aagtctttgttttctattaaaccgaacggtatgaatcactcagtacagctcatgtgtggt
gcatgctctgttgagaatgcactcaagcttgcattcatgtggtatatgaacaataaaaga
ggagatagaccaatttctcaagacgaactagatagtgcattgaaaaatcaatccccaggt
tgtcctaatatcactgttatgtccttttcaaatgctttccatggacgaacattaggttgt
ttgtcattgacacactccaaagcaatcaataaggttgattttccattgttcaaaggtccc
attgctcctttcccttcattaagatatcctcttgaagaacatgtgagggagaatgaagcc
gaagagaagaggtgtctggaagaagtagagaatctaatggaaagttatgaaaaaacatcc
ccagttgcagctgttattattgaaccaatacaaggagaaggaggagataatcatgcttcc
ccggaattttttaaaggattgcaaaaaatttgcttaaagtatggatcagctttcattgtg
gatgaagttcaaacttgtggaggatctactgggcagttttgggcacatgagtcctggggt
ctacctactccacctcatttagtaacgtttgcaaagaaactacaatcaggaggagtgttt
gcaattgatggaataataccaactcaaccttctcgaatattcaacacatggatgggtgaa
ccttctaaattactcttactatcagcagtacttgaagaaatgaagagagagaatttgttg
tctttagttagggagtctggtcatacactattatctggattaaagcaattgcaagagctg
tatccagggcacatcagtaaggcaaggggtgttggtacattttgtgcatttgatgctaag
aatagagatgagatggtatctaaattaaaagtgaaaggtattaatgttggtccttctgga
agagagtccatcagaatgaggcctgctcttatattccaatcaaagcatgctgaaatattt
cttaatgcattggaaacaatattgaaagaaatgtag

DBGET integrated database retrieval system