KEGG   Amphimedon queenslandica (sponge): 100637545Help
Entry
100637545         CDS       T02284                                 

Definition
serine/threonine-protein kinase NLK2-like
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:aqu04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:aqu04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 395 aa AA seqDB search
MSSLPFNCTLAVELSHPIGYGSFGVVWSVKNPRTGGLSALKRIPRVFQSLLSCVRTFREI
KMLCELKHDNILSAIDFIKPDNMEEFSDIYVLTDLMETDLHHIIISPQPLTEDHIKLFLY
QLLRGVKYLHSAGIIHRDLKPGNLLVNSTCLLRICDFGFARAVEVNPRTPMTLEVVTQYY
RAPELLAGCQQYGPAIDMWAIGCIVGELLGRKILFKGSDADSQLDLILELLGTPSAPDIS
HISSPVSRKRLLSVTRPNTMQEVLYQLSPNASHGVVHLLSRMLVFNPYKRISCHDSLSHP
YIDEGRVRFHSFLCSCCYTFHGMRQYSSELEPSASSTFNQKYEKELTSIHTAKAHIFAYV
SSVNAHLPSLQINQNSDQYQKFLSYCPGSGPAPDN
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgttaccttttaattgtacacttgccgttgaattgagtcaccccattggttac
ggatcctttggtgttgtctggtctgtcaagaacccaaggactggtggtctgtcagcttta
aagaggataccgcgagtgttccagtccctcttgtcctgtgtacgtacctttagagagata
aagatgctctgtgaactgaaacatgacaatatattatcagccattgatttcattaaacca
gacaatatggaagaattcagtgacatttatgtattaactgatctaatggagactgaccta
catcacatcataatctcacctcagccattgactgaagatcacattaagctattcttatat
caactgttgagaggtgtcaagtaccttcattccgctggtatcattcacagggaccttaag
ccagggaaccttctcgtcaatagcacctgtctccttcgtatttgtgactttgggtttgca
cgagcagtagaggtcaacccacggaccccgatgaccctggaggtggtgacccagtattac
agggcacctgaactcctggcagggtgtcagcagtatggaccagctattgatatgtgggct
attggttgtatcgtgggggagctactgggtcggaaaatattgttcaagggttctgatgca
gattcacaattagacctcatcctagagttactggggaccccctcggctcctgatatcagt
cacatctcttctcctgtctccaggaagcggttgctatcggttactcgtcctaacacaatg
caagaggtactgtatcagctctcccccaatgcttcccacggtgtggtccacctactgagc
aggatgctggtctttaatccttacaagaggatcagctgtcatgattccttgtctcatcct
tacattgatgaaggacgggtcaggtttcattccttcctgtgcagctgttgctacactttc
catgggatgaggcaatactccagtgagctggagcctagtgccagcagcaccttcaaccag
aaatatgagaaagaactgactagtattcacactgccaaagctcatatatttgcatatgtc
tccagtgtcaatgctcatttgccatctctacaaattaatcaaaattctgatcaatatcaa
aaatttctgagttattgcccaggatcaggccccgcccctgacaattaa

DBGET integrated database retrieval system