KEGG   Amphimedon queenslandica (sponge): 100637822Help
Entry
100637822         CDS       T02284                                 

Definition
protein O-mannosyl-transferase 2-like
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100637822
Enzymes [BR:aqu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     100637822
Glycosyltransferases [BR:aqu01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   100637822
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 761 aa AA seqDB search
MADIEDSLTQAGETDSIASALKELSPSPKKDENKGREQKEDSIEPIPPRLRLARRLSSSS
SPIYSPSFNQKDWPFFTCLALVTVLSFATRLYTLNEPQHVAWDETHFGKHASWYIQGKFF
FDVHPPLGKLIIATAGVLSGYNGSFEFKEPGQKYEDTPYYGMRLGCVLFGIFLVPLAFLT
VWELVHSLSASVIAATMILCETGTLTLSQYILLDPPLMFFVMASTYCAVKFQSYKEEPYT
LEWWYFLVLTGIFLACTFSVKWVGLFVILLVGLMTIKDLWDILGDLRISMVDFMKQFMCR
ALCLILLPFLIYISIFELHFIALRYSGNGDGFFSSEFQATLVGNELYDQKVPEFLGYDAV
ITLKNHRGGGGLLHSHSHLYPEEMAEIRQQQVTAYSHKDDNNKWLVKRANDTNFNASDEY
QLVKNGDWIVLEHVSTKRNLHSHNIDGPITKSHKQVSCYGQDGVGDANDFWEVDIVGAKQ
GDPVRTVASRLRFRHVAVGCYLHSHSKQLPKWGWEQLEVTCNPYKDDSNNLWNVEGNVNP
KLPNISFEFYKPGFFSKLIESHQVMAESNNNMKPKEGEQTSQPWHWPLTWQGQLFSGGDY
RVYLLGNPIIFWGCDVLLILFVLFVLMKLVADQRSVNYLSISVFVNRFVSSGCFLILGWA
LHYLPFYLMGRVLYFHHYFPALMFIVMLGAIVIDSFIKLITCLISSRVKSFFFFSAFTLV
MSVLIGSFATFMPLSYGMSGSKSDNPESRMYGLKWLPHWDI
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atggcggacatcgaagattccttgacacaggccggagaaactgattctatcgcttctgct
ctcaaagaactatctccttcacctaaaaaagacgaaaataaaggcagggagcagaaggaa
gattccatagagccaattcctcctcgtcttagactcgcccgccgactctcttcatcatca
tctccaatatattctccttcctttaaccagaaggactggcctttctttacatgcctcgct
cttgttacggtcctctcttttgcaactagactctacacattgaacgagccacagcatgta
gcgtgggatgaaactcatttcgggaaacacgccagctggtatattcaaggaaagtttttc
tttgacgtgcaccctccattaggaaaactcatcatagccactgctggagtcctatcaggc
tacaacggctcatttgagtttaaagaacctggacagaagtacgaggacactccttattac
ggaatgagacttggttgtgtcctttttggtatatttcttgtcccgttggcttttctgacc
gtttgggaacttgttcattcattatctgcttcagttatagcagcgaccatgatactgtgt
gagacaggaacactaaccctctcgcagtacatattgctcgatcctcctctgatgtttttt
gtgatggcatccacttattgtgcagttaaatttcaaagctataaagaagaaccttacaca
ttagagtggtggtacttcttagtgctcactggaatattcctagcctgtacatttagtgta
aaatgggttggattgtttgtcattcttttggttggtctcatgacgattaaagatctctgg
gatatactgggggacctcaggatatcaatggttgattttatgaagcagtttatgtgtcgt
gcactttgtctgattttactacctttcttgatatatatcagcatatttgagcttcacttt
attgctctgagatacagtggtaatggtgatggtttctttagttctgagtttcaagcaaca
ctagtggggaatgaattatatgaccaaaaagtccctgaattccttggttacgatgccgtt
attactctcaagaaccacagaggagggggaggtctcctacactctcattctcacctttat
cctgaggaaatggccgagataagacaacaacaagttacagcatactcacacaaagatgat
aataacaagtggttggttaagagagcaaatgatactaatttcaatgctagtgatgaatat
cagttggtaaagaatggtgattggattgtcctggagcatgtatccacaaagcgtaatctt
cacagtcacaatattgatgggccgataactaaatctcacaaacaagtttcgtgttatggg
caggatggagtgggtgacgctaacgacttctgggaagttgacatagtcggtgctaaacaa
ggtgatcctgtcaggacggttgcttcacggcttcgtttcagacatgttgccgtcggctgc
taccttcactctcatagcaagcaactaccaaagtggggctgggagcagctagaggtcaca
tgtaatccttataaagatgactcaaacaacctctggaatgttgaagggaatgttaatcca
aagttgcctaatatctcatttgagttctacaagcctggcttcttctcaaagctaatagag
tcacatcaagtgatggctgagtccaataacaatatgaagcctaaagaaggagagcagact
tctcagccatggcactggcctttaacctggcagggccagttattctctggtggtgattac
agagtttatctgttagggaatccaattatattctggggctgtgatgtcctcctgattctc
tttgtcctttttgttctaatgaagttggtagctgatcagagatcagtcaactatctctca
atatcagtgtttgttaataggtttgtgtcttctggttgtttcctgatactaggttgggca
ttacactaccttcccttctacctaatgggtagggtcctctactttcatcattatttccct
gcactgatgttcatcgtgatgctaggagctatagtaattgactcattcattaaactcata
acttgtctcatctcatctcgagtcaagtccttcttctttttctctgcctttactcttgtg
atgtccgtattgattggaagttttgctacattcatgccactctcctatggcatgtctggc
tccaagtcagataatcccgagagcagaatgtacggcttgaaatggcttccacattgggac
atttag

DBGET integrated database retrieval system