KEGG   Amphimedon queenslandica (sponge): 100637866Help
Entry
100637866         CDS       T02284                                 

Definition
ubiquitin carboxyl-terminal hydrolase 19-like
Orthology
K11847  
ubiquitin carboxyl-terminal hydrolase 19 [EC:3.1.2.15]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100637866
Peptidases [BR:aqu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100637866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1041 aa AA seqDB search
MASGVEEDWYQSSEFVTVTLKLPRNLKRDDTTSLFKSKHCSLLLNGETIWDCHLSLPVAP
DKCRIKPAGKNRVEIKLKKDTPHRWEELRDTEYSDTEIDEDIFHTPPASPLHNDTPHNAP
PTAPPTSLPVPTVPPPVRTHCETPPTSLSKEVESLNDLSSDHATTNHVTRDQLLSEMSNS
FDEVKEEFFNLKHLPHDVIEKGDGVLVKIFVSQVVRDSCLVTFNKSSAVLQFRTKNIRFL
SLYPGTSCETQFMWKVKLYDVIKPDSSSYNVSDRHVQLVLNKSDPSVRWKSLERPVKSPR
ALTPVGGKPQEKGGADTPTLNNLDDDDDDDDDVNNLDDLSVANNKPVGKTAMNFEFNPFM
LHRTEKTTPTRMTPSTNACLSMPRPQQEASPQPSTSLFHRLPSDLFAGPSETGIANLGNT
CFMSSILQCLSNTVEVRDFFLGEKYRTDINKDNPLGCQGQLAECFYTMIDKLWSGKMAYI
SPRKIKDLIGSRRDEFSGYAQQDAHEFTTFFLDGLHEDLNRIKSKPVTAQIESDGRPDSV
VSEESWSNYKKRNDSFIVDLFGGQFKSLLVCPDCSKESVTFDPFSSLSVPLPVKSVTLSV
IFISKDPLTPPKEVVVSLSSESTLELVKASVATKTSVTMKNLRVFEVIKNGRLVNMAVNH
KKKLSEMKDNDFIVICEVLSFHEAKEKVIELHVTQRVKFRNLPSKCCGCGDKGSGFKRCS
RCKSVEYCSRKCQEDDWSRHRKRCNELRNNLEVVGLPFVISLPITQLTFDNIADRAEKYA
NWSVDCKKYSNGSDSAAGNNGHTPAPPLFFDLVPIDDLCTTVGSPLLNRGKDTLTLTNRC
LLSMDWRNNPNDSSWVDVINKDLSAYQSSAKEAIKREGRHIRLKDCLQLFTEPETLPKEN
AWYCPRCKEHREATKRLSVSRLPHILIIHLKRFSFSDLTRRTKIDKHVEFPLTGLDMSPY
IHTDPSSYTAATNGTPALYDLYATVNHYGAVFAGHYVANVLSQNGDKRDWLRYDDENVTR
ISKNYISDNSTYLLFYRRRES
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaggtgttgaagaggactggtaccagagcagtgagtttgtgactgttactttg
aaattgccacgaaacctaaagagagatgacaccacttcactttttaagtccaagcactgc
tccttgctcctcaatggtgagactatttgggattgtcatttgtctttgcctgtagcacct
gacaagtgtcgtatcaaacctgctggtaaaaatagagttgaaatcaaactgaagaaagat
acacctcacaggtgggaagagcttagggatactgaatattccgacacagaaattgatgag
gatatatttcacactccgcctgcttcgcctttacataatgacacacctcacaatgctcct
cctactgccccacccacttcactccctgtacctactgtccctccacctgttcgtactcac
tgtgaaacccctcccacttcactctctaaggaggtggagtcactaaatgatctttcatct
gatcacgcaaccactaatcacgtgactcgtgaccagttgctgtctgagatgagtaattct
tttgatgaagtaaaagaagaattctttaatttgaagcatttaccacatgatgtcatagaa
aagggcgatggtgtcttagttaaaatatttgtatcacaagttgtccgtgattcttgtctt
gttacttttaataaatcctcagcagtactacaattcaggacaaagaacattaggttcttg
tcattgtaccctgggaccagctgtgaaacccagtttatgtggaaagtcaaactatatgat
gtcataaaacctgacagctcatcctacaatgtcagtgataggcacgttcagttagttttg
aataagtcggacccgagcgtcagatggaagagccttgagagaccagtcaagagcccaagg
gccctcactcctgttgggggcaagcctcaagagaagggaggagctgacacacccactctc
aataatcttgatgatgatgatgatgatgatgatgatgttaataaccttgatgatcttagt
gttgctaataataaaccggtcgggaagactgcaatgaattttgaatttaacccttttatg
ttgcacagaacggaaaagaccacacctactaggatgacacctagcactaatgcatgtctc
agcatgccacgcccccaacaagaggcgagcccccaaccgtcgacttcattattccatcgc
ctcccgtcagacttgtttgccggtcccagtgagactggtattgctaaccttggcaacacc
tgcttcatgagcagtatcctccagtgcctcagtaacaccgttgaagtgagggacttcttc
ttgggagagaagtacaggactgacattaacaaagataatcctcttggttgtcaggggcaa
ctcgctgagtgcttttatacaatgattgataagctatggtctggaaagatggcgtatata
tcaccaagaaaaataaaagacttgattggatcaagaagggatgagttcagtggttacgca
cagcaagacgctcacgagtttacaaccttcttcctcgacggacttcatgaagacctcaac
agaataaaatcaaaaccagtcactgcacagattgagagcgatggtagacctgattcagtt
gtatcggaggagtcttggtctaattataagaagagaaatgattcttttattgttgatttg
ttcggaggtcaatttaaatcattgctagtgtgtccggactgtagtaaagagtctgtgacc
tttgaccccttcagttctctctctgttcctcttccggtgaaatctgtgaccttatcagtc
atattcatttctaaagaccctctgactccacccaaagaggtggtggtcagcctttcttcg
gaatccactcttgaattggtaaaagcttctgttgctactaaaacaagtgtcactatgaag
aatttacgagtgtttgaagttattaaaaatggtcgtttagttaatatggccgtcaatcat
aaaaagaagttgtcagagatgaaagacaatgattttattgtgatttgcgaggtattatcg
tttcatgaagcaaaagagaaggtcattgagttacacgtaactcagagggttaagtttcgt
aatcttccttcaaaatgttgtgggtgtggtgataaagggagtggctttaagagatgcagc
agatgtaaatcagttgaatattgtagcagaaagtgtcaggaagatgattggtcaaggcac
aggaagaggtgtaatgagctaaggaataatttggaggtggttggtcttccttttgttatc
agtttaccgatcactcaattgacttttgataatattgcagatagagctgaaaaatatgcc
aattggtctgttgattgtaaaaaatattcaaatggttctgattcagcagctggtaataat
ggacacacacctgccccgccccttttctttgatttagtacctatcgatgacctttgtaca
acagttggaagccctttactgaatagaggtaaagacacattgacattaacaaatcgttgt
ttactgtcaatggactggaggaataatcctaatgacagcagctgggtggacgtgattaat
aaagatttatcagcttaccagagctcagccaaagaagccattaaaagagaaggcagacac
attagattaaaggattgtcttcaactatttactgaaccagaaacattgcctaaagagaat
gcatggtattgtccaaggtgcaaggaacacagagaagccaccaagaggctctccgtttca
agactccctcatattcttataatccatctcaagaggttttcattcagcgacttgacacgg
aggacaaagatagacaaacacgttgagtttccattgactgggttagacatgagtccatac
atacacacggatccctctagctacacagctgctactaatggtaccccagcactgtatgat
ttatatgccaccgtcaatcattatggggctgtgtttgctggccattatgtggctaacgta
ctctcacaaaatggagacaaaagagattggctccgctatgatgatgaaaatgtcacaaga
atatcaaagaattatatatcagacaatagtacttatctattgttctacaggagaagagag
agctaa

DBGET integrated database retrieval system