KEGG   Amphimedon queenslandica (sponge): 100637903Help
Entry
100637903         CDS       T02284                                 

Definition
(RefSeq) histone deacetylase 4-like isoform X3
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100637903
Chromosome [BR:aqu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100637903
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 838 aa AA seqDB search
MYACMYVCVPQDGNATVPGWLSVDNPNSPTAMDSANSSNESLNIDGKTSSQHDMPSLSNL
KLPHSSLTGSPLQMSPAWILPSISTAAAAAGGVGQLQAVTMPTQEQIEALQQKQLEMLSL
IEQQKQFAAAAAAATTSGGKPPELFQFPIAIWPTAVGSNQLLTSSPLTSSVTVSTGTTSA
ISSVASPTPSLSSLDSGFQSLAPPTENIAQHRPLGTSQSAPHGLKEPMTNEQYETLLRQF
QLQHQSLVVQQQQMYQHYLEQQQRVVQQAVLEKKRFEEQQRQLAGMHLEQQQQLQRQQQL
LRQMQEQQLLQLQRQQQLLLLQTLGVQQQHQASLQLKPKPAVHRVVNKAETLSLPYSSVH
GSSSSEGEGLVVGHTSIHRSLSANSSVDSLGSNNGQNSPVALAATTQDVKSPGVTGSGTG
LVYDTMMLKHNCCCGSSHPEHPGRLQSIWARLHETGIVQRSTRLRARKASLAELQCVHSE
NHVRLYGRPNKLKTSQDKKDMAGMRAFVQMSCGGAGVDTDTYWNDQHTSNAARMAVGSVI
ELADKIVNGDIQNGFALIRPPGHHSLQNQAMAFCYFNNIALAAKAMIAKNKKVAIVDWDI
HHGNGTQQIFYDNPAVLFISLHRYDNGTFFPGTGRPEEVGSGGGTGYNVNIAFSGKQSFQ
GVTTSNFGDPEYLAAFRSVVIPILRSHNPDIILVSAGFNATNGHPPTLGGYSVTPKCYAH
LTRMLMNCGNGRVAIALEGGFELMSLCESAEAVMRALLFENLPPLDAASLTRGPQPTAVA
SIEKTIACQKPYWSCLQQSVPILNMSQAEAERCDETVAALASLSMSGSKGGMKSPITS
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcatgcatgtatgtatgtgtacctcaagatggtaatgctactgtcccaggatgg
ctctctgttgataatcctaatagtcctacggccatggattctgctaattcctccaatgag
tccctcaatattgatggtaagacctcctcgcaacacgacatgccttctctctctaacctc
aaattaccccattcttctctcactggttctcctctccagatgtcgccagcatggatcctt
ccttccatctctacggctgcagcagcagcaggaggggttgggcagctccaggcagttacc
atgcccacacaggagcagattgaagctcttcaacagaaacagcttgaaatgctttctttg
attgagcaacagaaacaatttgcagctgctgcagcggcagcgacgactagtgggggtaaa
cctccggaattgtttcagtttcctattgctatatggccgactgctgtaggctccaatcag
ttactgacctcgtctcctctgacctcctctgtcactgtctctactggtaccacctctgcc
attagctccgtcgcatcaccaactccatcactctcaagtcttgatagtgggtttcagagc
ttggccccgcccacagagaatattgcgcaacatcgtccgctgggtactagtcagtcggcc
ccgcatggtttaaaagagccgatgactaacgagcagtacgagaccttgttaagacagttc
cagctccagcaccagtcgctagtggttcagcagcaacaaatgtatcagcattatctagag
cagcagcagcgagtggtacagcaagcagtactggagaagaagagatttgaagagcagcag
agacaactggctggcatgcaccttgagcagcagcagcagctccaaagacaacagcaactc
ttgagacaaatgcaagagcagcagctgctacagttacagagacagcaacagttgctcttg
ttacagacgctcggcgttcagcagcagcatcaagcctcgctgcagttgaaacctaaacca
gctgtccaccgtgttgtgaataaggcagagacactctcactcccttattctagtgtccat
ggctccagctctagcgaaggggaggggctggtagtaggccacacctcaatacacaggagt
ctatcagctaatagtagtgttgatagtcttgggtctaataatggacagaactcacctgtg
gccttggcagccactacacaggatgtgaagtctcctggcgtgactgggtctggtactggc
ctggtctatgatacaatgatgctgaaacacaactgctgctgtgggtcatctcacccagag
catcccggaagattacagagtatatgggcccgccttcatgagactggaatagtccaaaga
tcaacacgtctaagagccaggaaggcttcattagctgagctacaatgcgtacacagtgag
aatcacgtcagactctacgggcgtcctaacaaactcaaaacaagccaagataagaaagac
atggctggcatgagggcatttgtacagatgtcttgtggtggggctggagtggacacagat
acttactggaatgaccaacatacttcgaatgcagctagaatggcggttggctctgtcatt
gagttagctgataagattgtcaatggagacatacaaaatgggtttgctctcattaggcca
cctggacatcactcgctgcagaatcaagctatggccttttgctatttcaataacattgca
ctagcagcaaaagcaatgattgctaagaataagaaggttgccatcgttgactgggacatt
catcatggcaatggcacacagcagatattctatgacaaccctgctgtactctttatctcg
ctccatcgttatgacaatgggaccttttttccagggacggggaggccagaagaggttggt
tctgggggtggtactggttataatgttaacattgcattcagtggaaagcaaagctttcaa
ggagtgactacttcaaactttggcgatcctgagtatttagctgccttcaggagtgtagtc
attccaatattaagaagtcataatcctgacattattttagtatctgctggtttcaatgct
accaatggtcacccacccacacttggaggatactcggtcactccaaaatgctatgcacac
ttgaccaggatgttgatgaactgtgggaatggacgagttgccatagctctggagggcggg
tttgagctaatgtccttgtgtgaatcagctgaggccgtcatgagagctttattgtttgaa
aatttgcctccattggatgctgcatcgctgaccagaggtccccaaccaactgcagtagct
tccatagaaaaaacaattgcatgtcaaaagccgtattggtcctgtctccagcaatcagtt
cctattctaaatatgtctcaggctgaggctgaaagatgcgatgaaacagttgctgcactt
gcctctctctccatgagtggcagtaaaggaggcatgaaatctccaattacctcctaa

DBGET integrated database retrieval system