KEGG   Amphimedon queenslandica (sponge): 100637903Help
Entry
100637903         CDS       T02284                                 

Definition
histone deacetylase 4-like
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
aqu  Amphimedon queenslandica (sponge)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 938 aa AA seqDB search
MEMGLTGGEDGNPRGPGIDTSVGAPSGVDMIEICPHLPPRSTSVIVSITGDRSSPEEAHQ
TDNDGLSSRSATVSPSFGGPAESPLLNQRLVAKHLQVRQTLSEPSKAKLHRPKQHRMSPI
PKRHEVSKTLSMSESLNIDGKTSSQHDMPSLSNLKMSPAWILPSISTAAAAAGGVGQLQA
VTMPTQEQIEALQQKQLEMLSLIEQQKQFAAAAAAATTSGGKPPELFQFPIAIWPTAVGS
NQLLTSSPLTSSVTVSTGTTSAISSVASPTPSLSSLDSGFQSLAPPTENIAQHRPLGTSQ
SAPHGLKEPMTNEQYETLLRQFQLQHQSLVVQQQQMYQHYLEQQQRVVQQAVLEKKRFEE
QQRQLAGMHLEQQQQLQRQQQLLRQMQEQQLLQLQRQQQLLLLQTLGVQQQHQASLQLKP
KPAVHRVVNKAETLSLPYSSVHGSSSSEGEGLVVGHTSIHRSLSANSSVDSLGSNNGQNS
PVALAATTQDVKSPGVTGSGTGLVYDTMMLKHNCCCGSSHPEHPGRLQSIWARLHETGIV
QRSTRLRARKASLAELQCVHSENHVRLYGRPNKLKTSQDKKDMAGMRAFVQMSCGGAGVD
TDTYWNDQHTSNAARMVDTDTYWNDQHTSNAARMAVGSVIELADKIVNGDIQNGFALIRP
PGHHSLQNQAMAFCYFNNIALAAKAMIAKNKKVAIVDWDIHHGNGTQQIFYDNPAVLFIS
LHRYDNGTFFPGTGRPEEVGSGGGTGYNVNIAFSGKQSFQGVTTSNFGDPEYLAAFRLVI
IPILRSHNPDIILVSAGFNATNGHPPTLGGYSVTPKCYAHLTRMLMNCGNGRVAIALEGG
FELMSLCESAEAVMRALLFENLPPLDAASLTRGPQPTAVASIEKTIACQKPYWSCLQQSV
PILNMSQAEAERCDETVAALASLSMSGSKGGMKSPITS
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atggagatgggtctaaccggtggtgaagatggtaatccaagaggccctggtatcgacaca
agtgttggcgctcctagtggcgtggatatgatagagatatgtccacatctcccgcctagg
agtacgtcagtcatagtctccattacaggtgacagatcaagtcctgaagaagctcatcaa
actgataatgatggtttgtcctcccgctcagctactgtttcgccatcttttggcggccct
gccgaatctcctttattaaatcagagactagtagcaaaacatcttcaagttagacaaaca
ctgtctgagccttcaaaagctaagcttcatcgtccaaagcagcacaggatgagtccaata
cctaagagacatgaagtatcaaagacactatcaatgagtgagtccctcaatattgatggt
aagacctcctcgcaacacgacatgccttctctctctaacctcaaaatgtcgccagcatgg
atccttccttccatctctacggctgcagcagcagcaggaggggttgggcagctccaggca
gttaccatgcccacacaggagcagattgaagctcttcaacagaaacagcttgaaatgctt
tctttgattgagcaacagaaacaatttgcagctgctgcagcggcagcgacgactagtggg
ggtaaacctccggaattgtttcagtttcctattgctatatggccgactgctgtaggctcc
aatcagttactgacctcgtctcctctgacctcctctgtcactgtctctactggtaccacc
tctgccattagctccgtcgcatcaccaactccatcactctcaagtcttgatagtgggttt
cagagcttggccccgcccacagagaatattgcgcaacatcgtccgctgggtactagtcag
tcggccccgcatggtttaaaagagccgatgactaacgagcagtacgagaccttgttaaga
cagttccagctccagcaccagtcgctagtggttcagcagcaacaaatgtatcagcattat
ctagagcagcagcagcgagtggtacagcaagcagtactggagaagaagagatttgaagag
cagcagagacaactggctggcatgcaccttgagcagcagcagcagctccaaagacaacag
caactcttgagacaaatgcaagagcagcagctgctacagttacagagacagcaacagttg
ctcttgttacagacgctcggcgttcagcagcagcatcaagcctcgctgcagttgaaacct
aaaccagctgtccaccgtgttgtgaataaggcagagacactctcactcccttattctagt
gtccatggctccagctctagcgaaggggaggggctggtagtaggccacacctcaatacac
aggagtctatcagctaatagtagtgttgatagtcttgggtctaataatggacagaactca
cctgtggccttggcagccactacacaggatgtgaagtctcctggcgtgactgggtctggt
actggcctggtctatgatacaatgatgctgaaacacaactgctgctgtgggtcatctcac
ccagagcatcccggaagattacagagtatatgggcccgccttcatgagactggaatagtc
caaagatcaacacgtctaagagccaggaaggcttcattagctgagctacaatgcgtacac
agtgagaatcacgtcagactctacgggcgtcctaacaaactcaaaacaagccaagataag
aaagacatggctggcatgagggcatttgtacagatgtcttgtggtggggctggagtggac
acagatacttactggaatgaccaacatacttcgaatgcagctagaatggtggacacagat
acttactggaatgaccaacatacttcgaatgcagctagaatggcggttggctctgtcatt
gagttagctgataagattgtcaatggagacatacaaaatgggtttgctctcattaggcca
cctggacatcactcgctgcagaatcaagctatggccttttgctatttcaataacattgca
ctagcagcaaaagcaatgattgctaagaataagaaggttgccatcgttgactgggacatt
catcatggcaatggcacacagcagatattctatgacaaccctgctgtactctttatctcg
ctccatcgttatgacaatgggaccttttttccagggacggggaggccagaagaggttggt
tctgggggtggtactggttataatgttaacattgcattcagtggaaagcaaagctttcaa
ggagtgactacttcaaactttggcgatcctgagtatttagctgccttcaggttagttatc
attccaatattaagaagtcataatcctgacattattttagtatctgctggtttcaatgct
accaatggtcacccacccacacttggaggatactcggtcactccaaaatgctatgcacac
ttgaccaggatgttgatgaactgtgggaatggacgagttgccatagctctggagggcggg
tttgagctaatgtccttgtgtgaatcagctgaggccgtcatgagagctttattgtttgaa
aatttgcctccattggatgctgcatcgctgaccagaggtccccaaccaactgcagtagct
tccatagaaaaaacaattgcatgtcaaaagccgtattggtcctgtctccagcaatcagtt
cctattctaaatatgtctcaggctgaggctgaaagatgcgatgaaacagttgctgcactt
gcctctctctccatgagtggcagtaaaggaggcatgaaatctccaattacctcctaa

DBGET integrated database retrieval system