KEGG   Amphimedon queenslandica (sponge): 100638213Help
Entry
100638213         CDS       T02284                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:aqu00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:aqu00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:aqu04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 514 aa AA seqDB search
MASSLLCFVFVLHLFCCPASSASSSTGDVKWIRTAKDTSDRLTVQTPNLTFSSDFNFTVG
VTINSSIISLQLSLLMFRSLMYQTIVGFGGAFTDSASYVFSKLNSTHQAAILNMYFSEDG
LRYNMGRLPIGSCDFSYNHYTYDEVRDDENLTHFTIEHDKGYIIPFIREANATLNKWSND
SLYILASPWSPPAWMKVLDLPYCPLSCLECRLKDKYKKTWAEYFVKFIEAYGGEGVRVWG
VTVQNEPGACPVEYEGMHFDPETQRDFIKEYLGPSLRSSHPDVKLLIYDHNKNHVVKWVE
TIFSDPEASSYAWGTAVHWYSGDDFENLQSAHSLQPGKPILATEATVAREKNPENPKWEH
GEHYAHDMIGDFNNWVVGFIDWNLLLDRYGGPNHAGPQECEGLIKCGSAAMILADLETQV
LYPQVFYYYVGHISKYVPRGSVRINSRVTGSSSLECVAFLTPEKSIVVIVMNTGDESVEF
KLADVATAGAAGEQSVQALKVQALPHSIQTFLYT
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcatcctctcttctctgttttgtctttgtccttcacctgttttgctgtccagccagc
agtgctagcagctctactggtgatgtgaagtggattagaactgccaaggacactagtgat
aggttgacagttcaaacacctaatctgaccttttcttctgattttaacttcactgttgga
gttactattaacagtagtatcattagtttacaactgtctctgctaatgtttaggtcactc
atgtatcagacaattgttggttttggtggtgctttcaccgactctgcctcttacgtcttc
tcaaaactgaactccacccaccaggcagccatcttgaacatgtatttctcagaggatggt
ctccgatacaacatgggacgcctcccgattggatcatgcgacttctcgtacaatcactac
acgtacgatgaggtgagagacgacgagaaccttacccactttacgattgaacacgataaa
ggttatatcataccgttcattcgagaggctaatgctacgctcaataaatggagcaatgac
tcgctatatattttagcgtctccttggagccctcctgcttggatgaaagtattagacctg
ccgtactgtccactctcctgtctggagtgtaggctcaaggacaagtacaagaagacgtgg
gcagaatattttgtaaagttcatcgaagcctatggaggggaaggagtgagagtgtgggga
gttacagttcagaatgagccaggagcatgcccagtggaatatgaaggcatgcactttgac
cctgagactcagagagacttcattaaagagtatctaggaccgtctctcaggtcctctcac
ccggacgtaaagctcttaatatatgatcataacaagaaccacgtagtcaaatgggtggag
actatattctctgatcctgaggcctcgtcttatgcctgggggacagcggtacactggtat
agcggagacgactttgaaaaccttcagtcggctcattcccttcaacctggtaaaccaata
ctggcaactgaagctactgtggctcgtgagaaaaatcctgaaaacccaaagtgggaacat
ggagagcattatgcacacgatatgattggggatttcaataactgggtggttggtttcatt
gactggaacctcctattggacagatatggaggccctaatcatgctggacctcaagaatgt
gaaggattgattaaatgtgggagtgctgccatgatattggctgaccttgagacacaggtc
ctctatcctcaagtgttttattattatgtaggacacataagtaagtatgttcctcgtggc
tcggtgaggatcaatagtcgtgtgactgggagcagtagtctggaatgtgtagctttccta
acgcctgaaaaaagcattgtagtgattgtgatgaatactggggatgagagtgtagagttt
aaactagctgatgtggctactgctggagctgcaggagaacaatctgttcaagcactcaaa
gttcaagcattgccacacagcatacagactttcttgtacacttag

DBGET integrated database retrieval system