KEGG   Amphimedon queenslandica (sponge): 100638213Help
Entry
100638213         CDS       T02284                                 

Definition
(RefSeq) putative glucosylceramidase 3
  KO
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100638213
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100638213
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100638213
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100638213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 501 aa AA seqDB search
MASSLLCFVFVLHLFCCPASSASSSTGDVKWIRTAKDTSDRLTVQTPNLTFSSDFNFTVG
VTINRSLMYQTIVGFGGAFTDSASYVFSKLNSTHQAAILNMYFSEDGLRYNMGRLPIGSC
DFSYNHYTYDEVRDDENLTHFTIEHDKGYIIPFIREANATLNKWSNDSLYILASPWSPPA
WMKVLDLPYCPLSCLECRLKDKYKKTWAEYFVKFIEAYGGEGVRVWGVTVQNEPGACPVE
YEGMHFDPETQRDFIKEYLGPSLRSSHPDVKLLIYDHNKNHVVKWVETIFSDPEASSYAW
GTAVHWYSGDDFENLQSAHSLQPGKPILATEATVAREKNPENPKWEHGEHYAHDMIGDFN
NWVVGFIDWNLLLDRYGGPNHAGPQECEGLIKCGSAAMILADLETQVLYPQVFYYYVGHI
SKYVPRGSVRINSRVTGSSSLECVAFLTPEKSIVVIVMNTGDESVEFKLADVATAGAAGE
QSVQALKVQALPHSIQTFLYT
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcatcctctcttctctgttttgtctttgtccttcacctgttttgctgtccagccagc
agtgctagcagctctactggtgatgtgaagtggattagaactgccaaggacactagtgat
aggttgacagttcaaacacctaatctgaccttttcttctgattttaacttcactgttgga
gttactattaacaggtcactcatgtatcagacaattgttggttttggtggtgctttcacc
gactctgcctcttacgtcttctcaaaactgaactccacccaccaggcagccatcttgaac
atgtatttctcagaggatggtctccgatacaacatgggacgcctcccgattggatcatgc
gacttctcgtacaatcactacacgtacgatgaggtgagagacgacgagaaccttacccac
tttacgattgaacacgataaaggttatatcataccgttcattcgagaggctaatgctacg
ctcaataaatggagcaatgactcgctatatattttagcgtctccttggagccctcctgct
tggatgaaagtattagacctgccgtactgtccactctcctgtctggagtgtaggctcaag
gacaagtacaagaagacgtgggcagaatattttgtaaagttcatcgaagcctatggaggg
gaaggagtgagagtgtggggagttacagttcagaatgagccaggagcatgcccagtggaa
tatgaaggcatgcactttgaccctgagactcagagagacttcattaaagagtatctagga
ccgtctctcaggtcctctcacccggacgtaaagctcttaatatatgatcataacaagaac
cacgtagtcaaatgggtggagactatattctctgatcctgaggcctcgtcttatgcctgg
gggacagcggtacactggtatagcggagacgactttgaaaaccttcagtcggctcattcc
cttcaacctggtaaaccaatactggcaactgaagctactgtggctcgtgagaaaaatcct
gaaaacccaaagtgggaacatggagagcattatgcacacgatatgattggggatttcaat
aactgggtggttggtttcattgactggaacctcctattggacagatatggaggccctaat
catgctggacctcaagaatgtgaaggattgattaaatgtgggagtgctgccatgatattg
gctgaccttgagacacaggtcctctatcctcaagtgttttattattatgtaggacacata
agtaagtatgttcctcgtggctcggtgaggatcaatagtcgtgtgactgggagcagtagt
ctggaatgtgtagctttcctaacgcctgaaaaaagcattgtagtgattgtgatgaatact
ggggatgagagtgtagagtttaaactagctgatgtggctactgctggagctgcaggagaa
caatctgttcaagcactcaaagttcaagcattgccacacagcatacagactttcttgtac
acttag

DBGET integrated database retrieval system