KEGG   Amphimedon queenslandica (sponge): 100638294Help
Entry
100638294         CDS       T02284                                 

Definition
galactocerebrosidase-like
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100638294
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100638294
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     100638294
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 334 aa AA seqDB search
MVLMLLMFSLVLLHLTTGQYNVDDSGGTGPKFDGIGGLSAGASTALLPSYSEEIVSQILD
LLFKPNFGASLQICKVEIGGDGQSTDGTESSHMHSQDDENYHRGYEWWLMTEAKKRNPNV
KLYGLPWTFPAWVGNGSGSPYKYPELTAGYIIKWIQGAKSTYGLDIDYIGVWNERNFDST
YIKTLRKSLDSAGLNKVQIVAPDGSETVSLSIDVLLPNVSDTSTAAFLAARVSGVGCGTT
RAVGVFFWIDTSGTWTISSDLAGDKKVASGSFSAKPDTVYTLSMDVNGSSATVSVNGTAL
SSNVSVGNGKGFVGFGTSGYFPAEFDNFSLTKAS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggtcttgatgctgttaatgttttcattggtgctgctgcacttaactacagggcagtac
aatgtggatgattctggtggcactggaccaaagtttgatggtattggtggattaagtgct
ggagcatccactgcacttttgcctagttacagtgaagagatagtgtcacagattcttgac
ttattgtttaagccgaattttggtgcttctttgcaaatttgtaaagttgaaattggtgga
gatggacaaagcacagatggtacagagtcatcacacatgcatagtcaagatgatgagaat
tatcatcgtggatatgaatggtggctcatgactgaagctaaaaaacgtaatcctaatgtc
aaattgtatgggctcccttggacttttcctgcttgggtcggtaatggtagtggtagtcca
tacaagtaccctgaactgacagctggttatatcattaagtggatacagggagctaagagt
acatatggactggacattgattacattggagtatggaatgagcgtaattttgattcaacg
tacattaaaacattacgtaaatctctagactcagctggtttaaataaagttcaaattgta
gcacctgatggatcggaaactgtctctctttcaattgatgtgttattgcctaatgttagt
gataccagcactgctgcattccttgctgcaagagtaagtggtgttggttgtggtacaact
agagctgttggagtcttcttttggattgatacttcaggaacatggaccatatcttctgat
cttgctggtgataagaaagttgctagtggtagtttctctgctaaacctgatactgtgtat
acactgagtatggatgttaatggcagctcagccactgtatcagttaatggcactgcattg
tccagtaatgtgtctgttgggaatggtaaaggttttgtgggctttggtacttctggttat
tttccagctgaatttgataattttagcttgactaaagcttcttag

DBGET integrated database retrieval system