KEGG   Amphimedon queenslandica (sponge): 100638379Help
Entry
100638379         CDS       T02284                                 

Definition
protein disulfide-isomerase A3-like
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100638379
Enzymes [BR:aqu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100638379
Exosome [BR:aqu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100638379
  Exosomal proteins of colorectal cancer cells
   100638379
  Exosomal proteins of bladder cancer cells
   100638379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 491 aa AA seqDB search
MVRSLFFLACLVFLAFADEEDDPGDVIVLDDSNFAEGVNVDLILVEFYAPWCGHCKRLAP
EYKQAATLLKQSDPPVPLAKVDCPANTAICNKYGVSGYPTLKIFRNGEISSDYNGPRSAP
GIVSYMEKQSGPSSKELGSVQDLKNFIDSDEHTVIGFFTGDDSKLRTAFMSTANSMREDF
KFAHTTASEVLEEYGYSDQVAIFQPPYMVTKLDPSPFVYEGDATASALREFIESEHMGIA
GVRSTDDVKFYDEKPLCVVYYDVDYTKNPKGTNYWRNRVIKVAKQFADDGVHFAVSDNED
FRNEVEALGLTGKEPTAGIYDAKGKYAMSKDFSVDSLKEFVQDYLDGKLEPHIKSEPVPA
DNTGPVTVVVGKNFDEIVNDDSKDVLIEFYAPWCGHCKALAPKYDELGDKLKGDTNIVIA
KTDATANDYPPQFQVQGYPTIFWVPAGNKSNPQRYEGGREVSDFLKFIKDNATNKPVKVE
GEKSKKKKKEL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggttcgttctttgttcttcttggcctgtctggtcttccttgcttttgcagacgaagaa
gatgaccctggtgatgtcatagtgttggatgactccaactttgccgaaggagtcaatgtt
gatctcattttggtcgagttttatgctccatggtgtggccattgcaaacgtcttgctcct
gaatataaacaagcagccacactattgaaacaaagtgacccaccagttccactggcaaag
gttgactgccctgctaatactgctatatgcaacaagtatggagtctctggctatcctaca
ctcaagatattcagaaatggcgaaatcagctccgactataatggaccaagatcagcacct
ggtattgtttcttacatggaaaaacaaagtggacccagctctaaagaacttgggtctgta
caagatttgaagaatttcattgatagtgacgaacatacagtcattgggttcttcactggt
gacgacagcaaactgaggacagccttcatgtcaactgctaactcgatgagagaggatttc
aaattcgctcacacgacggcatcagaagtactagaggaatatggatactcggatcaggta
gctatattccagcctccttacatggtaacgaaattggatccgtcgccatttgtgtatgaa
ggagatgctactgctagtgcactgagagaattcattgaatcagagcatatgggtattgct
ggtgtaagatctactgatgacgtgaagttttatgacgagaagccgctctgtgttgtgtat
tatgatgtcgactatactaagaatcctaaaggtacaaactattggcgtaacagggttatt
aaggttgctaagcagtttgctgatgatggagttcactttgccgtgtccgataatgaagat
ttcagaaatgaagtcgaagcactgggactcactggcaaagaaccaactgctggtatttat
gatgctaagggaaaatacgccatgtcaaaggacttcagtgttgactcactgaaggaattt
gtgcaggactacctggatgggaaacttgagcctcatattaaatcggaacctgttcctgct
gataatacaggacccgttacagttgttgttggtaagaattttgatgaaattgtaaacgat
gattccaaagatgtcctgattgaattctatgccccatggtgtggccattgtaaagcactt
gcacctaaatatgacgaattaggagacaaactaaaaggtgataccaatattgtcattgct
aaaactgatgccactgctaatgattatccaccacagtttcaagtccaaggatatcctacc
attttttgggtaccagctggcaataaatccaacccacaaagatatgaaggtggtagagaa
gtctctgatttcttaaagttcattaaagacaatgctaccaataaacctgttaaggttgaa
ggagagaaaagcaagaaaaagaagaaggagctgtaa

DBGET integrated database retrieval system