KEGG   Amphimedon queenslandica (sponge): 100638383Help
Entry
100638383         CDS       T02284                                 

Definition
uncharacterized LOC100638383
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:aqu04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1278 aa AA seqDB search
MATKNKTPKPLHLASSVKELNDQSANDNIKSANPKLLCRSADKLNIAALEKMIDGDQEAA
YILLMRYLDVVSKIRASKEYKLNKKSFDGLLDLKKFKKALDDAESLSSELEKRYQEANAS
SSNSGTESSTGAETQTEDSLGPFVPPEKLYQILVDKSDKILVLDCRSRSEYVTSHVDNKK
YPQWLSVPEEVIITGNLTTFMSSTNQKLWDERGSKGRPYIILVDKKTDQNSVQESLPVMV
LKEKLKEEKLTVSILEGGYNMWYLAYAPLCVGKWKERVIPQSSTDNKDTGGDVSYPTFPF
SSSEDQHVPGKDYPPHSNNPPSVNRSTKPATLASDEQSKVNQGPLAYHTSQPIPQDPTGP
PVQPSGYSPSAQRTQSSNGQPINQPIAQYSNLPTAYQPGVHPTNQPLGYPTNQPLGDPTN
QPLLHPNSQPGMHPNTLSNPNLPMAQPPMHTATGQPLVYPPAGQQSMNQPMLNPTGQVPV
LYSTGQAPNGHPGMPTTANPHIAQQTGYYGQPVPTFTAQPLPPAPSVNLPLDLEGRGVLF
SNEIEPIEFLEEWYPPADTYYHDSAYGSSEEEASQQLQQYANANNPRQAYGPLPVPPNYE
EAQLLPSHPPVQPPLPPPVSIPIPQENIEDGSASSSKSNDAPAEAEKNTETKTVDIKEQV
RALVEEQLVAERAKMKEELKEEREKDKAILAEDRKRQELEYEQHKKEMEKQMSMMKEEYE
KEKKSMMKHQEEMKHYWQSRQVDNEQQRPVIINQGLPTGWEKRLDRTTNRFYYVDHNTHT
THWNPPTSILQYQAELAERQRQIASGPVPQPPPNGVPAGGHPSASPPVVGRGQQVKPNDL
IPTPVGGRGQPPLIPGRGQPPPVSGRGQSPPVSGRGQSPVSGRGQVVPGDHNQVAKSSGP
TGRPALPQIDRTTKPKQAPPMSPDVYRQKIINLQPVQGGIGPGLTGLRNLGNTCFMSSVI
QCLCATPPLVKYFFNGQYRADLNRSNPLGSGGILAEEFYILVAAIWLGKFRYIAPLEFKN
TVSQVAPYFAGNEQHDSQEFLVYLLDGLHEDLNKVLVKSYVELPDTDGVPDPVAVEQAWQ
AHKKRNNSIIIDLFHGLLKSTITCLSCGKKKVMFEPFVSLSVPIPRGRTSCSYHDCFKLF
TAKERMTGTNKWFCPQCKASRDSEKTLFIWRLPPILLLHFKRFQDKGTVREKLSTSISFP
IESLDLNSYVVGPRPTNQYSLYAISNHTGSLQSGHYTATCRHPRSQKFHFFDDQDVRQTS
SQNINVSDSACLSRFVPN
NT seq 3837 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaaaaacaagactccaaaacctctccatttagctagcagtgtcaaagaattg
aacgatcagtccgctaatgataacataaaatcagcaaacccaaagctgttatgcagatca
gcagacaaacttaacattgctgcacttgagaaaatgatagacggtgaccaagaggcagct
tacatcctcttgatgaggtaccttgatgtggttagtaagatacgggcatcaaaggaatac
aagctgaataaaaaatcatttgatgggttgcttgatttgaagaaatttaaaaaggctctt
gatgatgctgagagcttatcctctgagttagaaaagagatatcaagaagcaaatgcctct
tcaagcaatagtggcacagagtcttccactggagctgagactcagactgaagattcactt
ggtccttttgtacctcctgagaaactttaccaaatcctggtggataaaagtgacaagatt
ttagtcttagactgtaggtctcgtagtgagtatgtgacatctcatgttgataataagaaa
taccctcagtggctttctgttcctgaggaagttataatcactgggaatttgacaactttc
atgtcttctactaatcagaagttatgggatgagagaggtagtaagggacgcccgtacatt
attctagtggacaagaagactgatcaaaactcagtccaagaatctttacctgtgatggta
ttgaaagagaaactcaaggaagaaaagttaacagttagtatactagaaggtggttataat
atgtggtacttggcatacgctccactctgcgtcggtaaatggaaagaaagagtcatccca
cagtcaagtactgataataaagacactggaggtgacgtttcctatcctacttttccattt
tctagcagtgaagatcagcacgtgcctggaaaggattatcctcctcatagcaataatcct
ccttctgttaaccgatcaacaaaaccagctactctagcatcagatgagcagtctaaggtt
aatcaaggaccacttgcataccacaccagtcagcctatcccacaggatcccactggccct
ccagttcaaccttctggctattctcccagtgctcaaaggacccagtcttctaatggtcaa
ccaataaatcaacctattgcacaatactctaatctgcctactgcatatcaaccaggggtg
caccctactaatcaaccattaggataccctactaatcaaccattaggagaccctactaat
caacccttactacaccctaatagtcaacctgggatgcaccctaatactctgtctaatccc
aatcttccaatggctcaaccaccaatgcacactgctactggtcaacctcttgtatatcct
cctgctggtcagcaaagtatgaatcagccaatgctaaaccctactggtcaagttccagtg
ttgtattcgactggtcaagcaccgaatggtcacccagggatgcccactactgctaatcca
catattgcccaacagactggttactatgggcagccagtccctacttttactgctcaacca
cttcctcccgctcccagtgttaatttgcctttagatttagaagggcgtggagtattgttc
tctaatgagattgagccaatagagtttcttgaagaatggtatcccccagcagatacctac
tatcatgatagtgcctatggcagtagtgaggaagaggcctcacagcaactccagcaatac
gctaatgctaataatcccagacaagcttatggcccattaccagttcctcctaattatgaa
gaagcacagttattaccatctcatcctcctgttcagcctccactaccacctcctgttagt
ataccaataccacaagaaaacattgaggatggctctgcttcctcctcaaagagtaatgat
gcaccagcagaagctgaaaagaatacagaaacaaaaactgttgacatcaaagagcaagta
cgtgcactggtagaagaacagttggtagccgaacgggcaaaaatgaaagaagaattaaag
gaagagagagagaaggataaggcaattttagctgaagacagaaaaaggcaagagctggag
tatgagcagcacaagaaggagatggaaaaacaaatgtcaatgatgaaggaagaatatgag
aaagaaaagaaatcaatgatgaagcaccaggaagaaatgaaacactactggcaatcaaga
caggtggacaatgagcaacagcgaccagtcattattaatcagggtcttcccactggatgg
gaaaaaagacttgataggactaccaaccgtttctattatgttgatcataatacgcacacc
acacactggaacccaccaacatctatcctacagtatcaagctgaactagctgaacgtcag
agacaaatagccagcgggcctgttcctcaaccacctcccaacggagtccctgcaggagga
catccttcagcttctcctccagtagttggacgtggtcaacaagtaaaaccaaatgacctt
atacctactcctgttggtgggcgtggtcaacctcctctcatacctgggcgtggtcagcca
cctcctgtatctggacgtggtcagtctcctcctgtatctgggcgtggtcaatctcctgta
tctgggcgtggtcaagttgttcctggggatcataatcaggtagcgaagtcaagtggccct
actggtagaccagcactgcctcaaattgatcgtactactaaacctaaacaagctccacca
atgtctcctgatgtgtatcgacaaaaaataatcaacctacagcccgtgcaaggaggaata
ggtcccggtctaactggtttaagaaatcttggtaatacttgcttcatgagttctgttatt
cagtgcctgtgtgccactcctcctcttgttaagtatttcttcaatgggcagtacagagct
gatttaaacaggtctaatcctttagggtctggtggtatattggctgaagagttttacata
ttggttgctgcaatatggctgggaaagtttcgatacatagctcccttggaattcaagaac
actgtctctcaagttgctccttattttgctggcaacgagcagcacgactcacaggagttt
ctagtttatttactggatggactccacgaggacctcaataaggtgctggtaaagtcttat
gttgagttgcctgatactgatggagtcccagacccagtggctgtagagcaagcatggcag
gctcacaagaaaagaaacaattctatcatcattgatctgtttcatggcctgttaaagagc
actatcacttgcttatcatgtggtaaaaagaaggtcatgtttgagccatttgtctcactg
tctgttcctataccgcgtggaagaacaagctgttcttatcatgactgctttaagttgttt
acggctaaggagcgtatgacaggaactaataaatggttctgtccacagtgcaaagcttca
agagattcagaaaaaaccctcttcatttggcgcctgcctcctatccttctccttcatttt
aaaagattccaagataaaggcactgttcgtgagaagctatcgaccagcataagcttccct
attgagtccttggacttgaattcatacgttgtgggccctagacccactaatcagtatagt
ctctatgcaatatcgaatcatactggaagtttgcagagtgggcattatacagcaacatgc
aggcatcctcgtagccaaaagtttcatttttttgatgatcaagatgttcgtcaaacatct
tctcaaaatataaatgtgagtgacagtgcatgtttgtcacgttttgtgcctaattaa

DBGET integrated database retrieval system