KEGG   Amphimedon queenslandica (sponge): 100638395Help
Entry
100638395         CDS       T02284                                 

Definition
protein disulfide-isomerase A6-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100638395
Enzymes [BR:aqu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100638395
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 449 aa AA seqDB search
MMKTLSSLLLLLTVSLVHGVYDSSDDVIELTPKNFDSQVMNGPEIWVVEFYAPWCGHCQA
LVPEYKKLARALKGIIKVGAVDASEHQSLGGRFGVQGFPTIKMFGGNKNKPRDYQSERKA
EAMMSQALSFAREVMNERLGGKSGGGGGGRGGGGRGGGSSGGGTPDDKDVIQLTDSNFED
KVLGSDEMWLVEFFAPWCGHCKNLAPEWAKAATQLKGKVHVAAVDATEHRVLASRFGIQG
FPTIKFFNSGKKDWDGAEDYTGGRTADSIVAWAMEKWEKEQPPPEVYQLTSQTVMDSCAE
KQLCFISFLPNILDSMASGRNRYLEIARSVGEQYKQRSFGWVWLEGGANSKLEEALEVGG
FGYPALVAVNGRKGAYSALRGPYSYDGIRSFVRELIAMKSPIVSIRGGKLPAIEDSEPWD
GKDGVLPVDDDDIDLSDVVLDDEPTKEEL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaacattatcatcattattattattattgactgtgtcattggttcatggagtg
tatgactcttctgatgatgtcattgaactaactccaaagaactttgactctcaagtgatg
aatgggccagaaatatgggtcgtcgagttttatgctccatggtgtggtcactgtcaggcc
ttggtaccagagtacaagaagttagctcgtgccttgaaaggtatcattaaagtcggtgcc
gttgatgccagcgaacatcagtcactcggagggaggtttggagtccaaggattcccaacc
atcaaaatgtttggagggaacaagaacaaaccaagagactatcaaagtgagcgcaaagca
gaagccatgatgtcacaagccctttcatttgcaagggaagtgatgaacgagagattggga
gggaaaagtggaggaggaggaggagggagaggaggaggaggaaggggaggaggaagcagt
ggtggtggtactcctgatgataaagacgttatacaactcaccgattctaattttgaggat
aaggttcttggcagcgatgagatgtggctcgttgagttctttgccccttggtgtggccat
tgcaagaaccttgctcctgaatgggccaaagccgccacacagctcaaaggaaaggtccat
gttgcagctgtcgatgccactgagcatagagtccttgctagccgttttggtattcagggc
ttcccaactataaagttttttaattcagggaagaaggattgggatggagcagaggactat
acaggtggtcgcactgctgattctattgttgcttgggcgatggagaaatgggagaaggag
cagcctcctcctgaagtgtatcaactaacgtcacagactgtcatggactcttgtgctgag
aagcagctctgcttcatatcattcctacccaacatactagacagcatggcatcaggaagg
aacagataccttgaaatagcaagatctgtcggtgaacagtacaagcagaggtcgtttggg
tgggtgtggctggagggtggagctaactctaaattagaggaggcacttgaagttggtggg
tttggttacccagctcttgtcgctgttaacggtcgtaaaggtgcttactctgcactccgt
ggcccgtactcatacgatggcattagatcatttgttagagagctgatagcaatgaagagt
cccattgtatcgataagaggtggtaagcttccggctattgaagattctgagccatgggat
ggaaaagatggagttttgcctgttgatgatgatgatattgatttgtctgatgttgtctta
gacgatgaaccaactaaagaagaattataa

DBGET integrated database retrieval system