KEGG   Amphimedon queenslandica (sponge): 100638474Help
Entry
100638474         CDS       T02284                                 

Definition
ubiquitin carboxyl-terminal hydrolase 7-like
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100638474
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100638474
Peptidases [BR:aqu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100638474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1113 aa AA seqDB search
MAEGKDSLSEETLPMETEDILTEEYSATCTVESPGQIMYPGADVRLSPAAGSRSCSPQVS
PAVSPTTNQAFTGESEVDPCKSNGLIKLTVPKVSQLEETYLSDPVYIRELPWRLMVMPKN
ARQDGGQESKSLGVFVQCDPETNDTPGWSVYAYARISLINQTDSDEKHTREISHWFSAKE
NDWGYASFLPWKDILYDEKGFVKDDRIILEARVSADAPHGINWDSKKHTGFVGLKNQGAT
CYMNSLLQTLFCTFKLRKAVYQMPTENDDSSRSVAFALQRLFYDLQYSDKVVGTKKLTKS
FGWDSIDTFMQHDIQELSRVLLDNMVNKMKGTSVQDCIPSLLEGKMETLISCTDIEYESR
REESFFDLQLNVKGKKNVYESIKDYTSPEVLDGDNKYCAGSHGMQKAVRKVLFVKFPPVL
HLQLMRFQYDMYSEGHSKINDRYEFPEHLDLNEYLKAPEGSPAHYTLHAVLVHSGDNFGG
HYVAYINPHGDGKWLKFDDEVVSRCSAKEAIDSNFGGHDDNFVIRNCTNAYMLCYIRDNE
IGKVLEEVTDNDIPLSLVKRIKDEKLVETLKRKERSEAHYYMSVEILTDDDFQHHHKSEL
YDNEEIKGRFFKILRALPFEVLHTHVAITMGYHKSQLRLWPFETRNNRTCRPSSNESPQT
TIFEVAESKNVIAMYAELVTPDCKELAPFDFQSQVLLFIKYYDPFTKTLTFVGHVTEEIS
LKFETLFPLFCSMANLPESTPLRIYEEVSQNRIEDLNPMAPISQIEEVKDGDIICFQRAD
ISLNSLELPLAPMYYKELFNRIDVSFYDKNIASDPGFTLTLNQKMSYLQMSSAVAAHLQI
DPFYIQYFRPNIHRQLSDQAIRCKNEGTLRDFVTKGRTDNNYYLFYQRLSIPIDQFETKK
SFKCIFVNHKLKEEREITVYVDKNGIVDDLLEVALLEIPLPDESTHKLRLVEVMGNRIVD
LHSRDKPVAELLSQKLYRIEEVRPEELSLSIGEALVPVAHFHKVPHNTFGVPFLLTIRNG
ELLSSVKGKIQKLLDINDKDLDKWKYYIVTSTATHSLLPEETDPPLYLEQFNLSPVDGVY
FSKAGTPWLGVEHFNKSPKRSRYNIERAIKIHN
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaggtaaggatagtctctctgaggagaccctaccaatggaaactgaagacatt
ttaactgaagaatattctgccacatgcacagtagagagtccggggcagattatgtatcca
ggtgctgatgttcgtttgtctccagctgccgggagtagatcatgttcacctcaagtctca
cctgcggtctcacctacgaccaatcaggcattcactggagagagtgaagttgatccttgt
aaaagtaatgggcttattaaactgacagtacccaaagtatctcaacttgaggaaacttac
ctcagtgatcctgtctacattagagagttgccatggagactcatggtaatgccaaagaat
gctagacaagatggcggacaggagagtaagtcacttggagtgtttgtacagtgtgaccct
gaaaccaacgacacacctgggtggagcgtgtatgcctatgccaggattagtttaatcaat
caaactgattctgatgagaagcacaccagagaaatatctcattggttttcagcaaaggaa
aatgattggggctatgccagcttcttaccttggaaggatatactttatgatgagaaaggg
tttgttaaagatgacagaattatattagaagcaagggtatctgctgatgctcctcatggt
atcaactgggattctaagaagcacactggatttgttggtttaaaaaaccaaggggcaaca
tgctacatgaattcgttactccagacattattttgcacttttaaattgagaaaagcagtt
tatcagatgccaactgaaaatgacgacagttcaagaagtgttgcttttgctcttcaaaga
ctgttctatgacttacagtacagtgataaagtggttggtacaaagaagcttacaaaatca
tttgggtgggactcaatcgatacttttatgcagcatgatatacaagaactgagtcgagtg
ttgttggataatatggtgaataaaatgaaaggtacttcagttcaggattgcataccgtca
ctgcttgaagggaaaatggagacattgatttcatgtacagacattgaatatgaatcaaga
agggaagagtcattctttgacttacaattaaatgtaaaaggaaagaagaatgtttatgag
tcaatcaaagactatacttctcctgaggttttagacggtgataataaatactgtgcaggt
tcccacggaatgcagaaagcagttcgtaaggttttgtttgtaaagttcccaccagttctt
caccttcaacttatgaggtttcaatatgacatgtacagcgaaggacattctaaaattaac
gacaggtatgagtttcccgaacacttggacctcaatgagtacctgaaggctcccgaagga
tctcctgcccattacacactgcatgcagtactggttcacagtggggataactttggcgga
cattacgttgcatacattaatcctcacggtgatggaaagtggttaaaatttgatgatgaa
gttgtttcaaggtgctcagccaaagaagctatagacagcaatttcggtggacatgatgat
aactttgttattaggaactgtaccaatgcttatatgctctgttatattagagacaacgag
attggtaaagtattggaggaagtgactgataatgacataccattgtctttggttaaaaga
ataaaagatgaaaaattggtggagactttgaagaggaaggagagaagcgaggctcactat
tacatgtctgttgagattttgactgatgatgattttcaacatcatcacaaatctgaactt
tatgacaatgaagaaattaaagggagattttttaagattttacgagctttaccatttgaa
gttctccacactcatgtagcaataacgatggggtatcataaatctcagttgcggctgtgg
ccttttgaaactcgtaataacagaacatgtcgtcccagttcaaacgagtccccccaaact
acaatatttgaagttgctgaatctaaaaatgtcattgcaatgtatgcagaacttgtaaca
cctgattgcaaagaattggctccatttgattttcaatctcaagttttactttttataaaa
tattatgatccttttacaaagactcttacttttgttggtcatgttactgaagaaatatca
ttaaaatttgagactttatttccactcttttgttcaatggctaatcttcctgaatcaaca
ccacttagaatttatgaagaagtgagtcagaacaggattgaagatttaaacccaatggct
ccaatcagccagattgaagaggttaaagatggggatattatttgctttcaaagagctgat
atttcattaaattcactcgagctccctctggctccaatgtattacaaggagctgttcaac
aggatcgacgttagtttttatgataagaatatagccagtgatcctggtttcacactgacg
ctaaatcaaaaaatgagttatttacaaatgtcttcagctgtggctgcacatttgcaaatt
gatccattttacattcaatacttcaggcctaacattcacagacagctgtcagatcaggcg
attagatgtaagaatgaaggaaccctcagggactttgtcaccaaaggaaggactgacaat
aactactacctcttttaccagcggttgtcaataccaattgatcaatttgagactaagaaa
tcttttaagtgtatatttgtaaatcacaaattaaaggaagaaagagaaattacagtttat
gttgacaaaaatggaattgttgatgatttactcgaagtggctctgttagagatcccttta
cctgatgagagcactcacaagttgagactggttgaagtaatgggtaataggattgttgat
ttgcattcaagagataaaccagtagctgagctactgtctcagaaactgtacaggatagag
gaagtaagacctgaggagttatcattgtccattggtgaagcattagtgccagttgctcac
tttcataaagtgccacacaacacatttggagttcctttcttattaactattagaaatggc
gaattgttgtcatcagttaaaggaaaaatacaaaagttacttgacattaatgacaaagac
cttgacaagtggaagtattacattgttaccagcacagcaacacactctctcctccctgaa
gagactgatccaccactgtatcttgagcagtttaacctctcaccggttgatggtgtctac
ttttcaaaggcaggtacaccttggcttggagtagagcatttcaataaaagtccaaagaga
tccagatacaatattgaaagagctatcaagattcataattaa

DBGET integrated database retrieval system