KEGG   Amphimedon queenslandica (sponge): 100638592Help
Entry
100638592         CDS       T02284                                 

Definition
(RefSeq) histone acetyltransferase KAT7-like
  KO
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100638592
Chromosome [BR:aqu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100638592
   HAT complexes
    HBO1 complex
     100638592
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 712 aa AA seqDB search
MSGEVGSGTTSANASTQSTPTPPNIGRRGRRLRKCATPIKSAKKDERGTFPQTGSLSLVL
PPGTNSSNSDVITPSSSTATTPAKIENETKATPIRAPLPSPSTLPGTSNLIKKRKRIPYT
LVEATKGIRCPTSGCYGLGHVTGLYAMHYAVSGCPIAAQAKKELEKDVIKPPRPPPPHPS
FRKKKRRFRSYKKKVPAQNGASKTGVTPPINEPHAIGETETLSKAPTTRLSSSKQTDSNP
QSSSVKPPSSAESTSKDSSVKKRKRIPYTLVEAVKGNRCPTPGCGGIGHITGLYSMHYAV
SGCPLAHGKTPEECKSRRDELNKSRAQASQTLESESALSPPPRKNPRLMASRNLSATLDS
VAIGDPLPPNNTPSFKTLPPNDNKKRFRMPEYYFRPEPKLEGLTSSQDLQLFREAQAKMR
EQLVNVEGKHTDYKLSKIIFGCYEIDTWYSSPYPPEYTELSQIYVCEFCLRYYKTVVTYN
NHTSCCVQRRPPGREIYRKNTLSVFEVDGENHKEYSQNLCLLAKLFLDHKTLYFNVEPFL
FYIVTRYDDTGCHIVGYFSKEKHSPQGFNVSCILVMPPHMRRGYGHLLIDFSYLLTRHQE
KVGSPERPLSDLGLLCYRSYWKDKVLSYLTKHNSQSISMKEISLETGISADDLISSLQYY
RILKYWKGKHIIIKKKELLEEHSCKVERHKSSDLTIDASCLKWMPTTYPVYP
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggagaggtcggtagtgggaccacctcagccaatgcaagcacccagtccactccc
actccgcccaacatcggtaggaggggccgaagactgagaaaatgtgccacgcccataaaa
tctgccaagaaagacgagagagggacgttcccacagactggcagcctttccctcgtcctc
cctccggggactaactcgtcaaattcggacgttatcactccctcttcatcaacagcgacc
acgcctgctaaaatcgaaaatgaaaccaaggccacgcctattcgtgctcctctcccatca
ccgtcgaccctacccggtacatcaaacctcattaaaaagagaaagaggataccctatact
cttgttgaagctactaaaggaattcgctgtcctacttctggttgttatggcctaggccac
gtcactggtctgtatgccatgcactatgctgtgtctggatgccctatcgctgctcaggca
aagaaagaactagaaaaggatgtcatcaagccgccacgcccgcccccgccccatccaagc
ttcaggaaaaagaaaagacggttccgatcctacaagaagaaagttcctgcacaaaatgga
gcatctaagactggagtgactcctcctattaatgagccacacgccatcggagagacagag
acattgtcaaaagcacctaccactcgattatcatcttcaaaacagactgattctaaccct
cagagctcgtccgtgaaaccaccttcgtctgctgagagcacgagtaaggacagctcggtt
aaaaagaggaagagaataccgtatacactagttgaagcagttaagggtaaccgctgccct
actcctggttgtggtggcataggtcacatcactggactttatagcatgcactatgctgtc
tctggctgtccattggctcatggtaaaacaccagaggaatgcaaatcgcgtagggatgag
ttgaacaagagtcgtgctcaagctagtcagactttagagtcagagtctgctttgtctcct
cctccaaggaaaaaccctcgtcttatggcttcaagaaacctctcggctactctcgacagt
gtagccattggggatcccttacctcctaataatactcctagttttaagaccctcccacct
aatgataacaagaagcgctttaggatgcccgagtattactttaggccggagccaaagctt
gaaggactcacgtcatctcaggaccttcagctgtttcgtgaagctcaggccaaaatgaga
gaacaactggtcaatgtagaagggaagcatactgactataaactatcaaagattattttt
ggctgctatgagattgatacgtggtactcttctccctacccaccagaatacactgaactg
tctcagatatacgtgtgtgagttttgtctcagatattacaagacggtcgtgacttataac
aatcacacttcatgttgtgtccagaggaggcctccaggtagagagatctatcggaagaac
actctctccgttttcgaagtcgacggagaaaatcataaagagtacagccagaatctctgc
ctcttggcaaagctgtttcttgaccacaagacgctatactttaacgtggagcctttcctc
ttttacattgtcacacgctatgatgacaccggctgtcacatagttggatacttttcaaag
gagaagcattcgcctcaaggattcaatgtctcgtgtatactagtgatgccacctcacatg
agacgtgggtacggtcacctcctcattgatttcagttacctattaactaggcaccaagag
aaggtcgggtcgccagagcgtcccctctcagacctggggcttctctgctatcggagttac
tggaaggataaagttttaagttatctaacgaaacacaactcacagagtatatcaatgaaa
gagataagtcttgagactggcatcagtgctgatgatctcatcagtagtctacaatattat
cgcattttaaaatattggaaaggaaagcacatcatcataaagaagaaggaattgctagag
gaacattcttgtaaagttgagagacacaagtcgagtgatcttacgattgatgcatcttgt
ttgaaatggatgccaaccacttaccctgtatacccttag

DBGET integrated database retrieval system