KEGG   Amphimedon queenslandica (sponge): 100638625Help
Entry
100638625         CDS       T02284                                 

Definition
cyclic AMP-responsive element-binding protein 1-like
Orthology
K09050  
cAMP response element-binding protein, invertebrate
Organism
aqu  Amphimedon queenslandica (sponge)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 305 aa AA seqDB search
MSSDSSPGNVASEKGIAPSISVTLPPPEKQSANTQSDDDEEPPPISSEQLLRRASFKKIL
EDLSSSAESINKPGLDPAAGVSMLQQAAGLAAATNPALLPILQNLQQSALTIANQPSAAT
AAGAGAAGGNNDFTQQLAAAMMLPNHINAQQQLTAALLNSQANAVAQAPLIANAVSLAGH
NNFQLPSNLLSSALLNASSNQLSNFGAQLPAGGGSGTPIGHKQSLRTVSSPEGFVGSPPL
PGEDSTKKREIRLMKNREAARECRRKKKEYIRCLENRVAVLESQNQALIGELRALKELYL
PKNQE
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcgactccagtccaggaaatgtggccagcgaaaagggtatagctccatccata
tcagtgacactgccaccacctgagaagcaatcggcaaatactcaatctgatgatgatgaa
gagcctcctccaatatctagtgagcagttacttagaagagctagtttcaaaaagatatta
gaggacttgtcgtcatcggctgaatccattaataaaccaggactagatcctgctgctgga
gtgtctatgttgcagcaggctgctggcttagcagctgctaccaatcctgctcttcttcca
attttacaaaacctacagcagtcggctcttactatagccaaccagccatcagctgccact
gcagcaggggctggagctgctggaggtaataacgatttcactcagcagttagcagctgct
atgatgcttccgaatcacatcaatgcacagcaacaactaacggcagctttattgaactct
caagctaatgctgtggcccaggctccactcattgccaatgctgtgtctctggctggtcac
aataattttcaattgccttcgaatttgctttcgtcagctttgctcaatgcttccagcaac
cagctatctaattttggcgcacagttaccagctggcggcggcagcggtacaccaatagga
cacaagcaatctttacgtacagtatctagtcctgagggtttcgtaggctctcctccactc
ccgggagaggattccactaaaaagagagaaataagactcatgaagaacagagaggcagcg
agagagtgtagacgcaagaagaaagaatacattcgctgccttgagaacagagttgctgtc
cttgagagtcagaaccaagcacttattggcgagctccgtgcactcaaggagctctatctt
cctaaaaaccaggaatga

DBGET integrated database retrieval system