KEGG   Amphimedon queenslandica (sponge): 100638632Help
Entry
100638632         CDS       T02284                                 

Definition
regulatory-associated protein of mTOR-like
Orthology
K07204  
regulatory associated protein of mTOR
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100638632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1297 aa AA seqDB search
MDHSTKDILPVDPEDASELDDWRLPLSYMKGRHLEDIAGLPPMKENWRIKERLKTWSVAL
ALCLNIGVDPPDVVKTTPCARKECWIDPLSRGSQKAMELIANSLQKQYERWQPRARYKQL
LDPTTDEVRKLCIALRKNAKNERVLFHYNGHGVPRPTVNGEIWVFNKSYTQYIPLSVYDL
QVWMGKPSVYVLDCSYAAQIVDSFKLFIRERESEFFLEGSINLSTSNSSCLGLLDESILL
AACGSKEILPMNPKLPADLFTACLTTPIKTALLWFCLQRVGKLVHGVTEEMIDNIPGKLN
ERKTPLGELNWIFTAITDTIAWNTLSQELFQKLFRQDLLVASLYRNYLLAERIMRSYNCT
PESHPYLPPTYQHPLWQAWDLAVDHIMAQLPQLIDGTQEYEPSSFFPEQLNAFQVWLLSF
PNLSQPPTQLPIILQFLLSQAHRLQALELLGRYLDMGPEAVHAALSVGIFPYVLKLLASK
LRELQPILVFIWAKILSVDNCCQSDLVKDGGYKYFISVLADTTIQFEYRTMAAFILSSIC
NNYSKGQEVCLQGNVVAICLSQLEEPNAVLKQWLAICLGRLWQKYDAAKWCGVRDAAHEK
LSLLLWDEVPEVRAAAVFALGTYIFTPSTDGSHTDHATSIDHSVAMLLLPLVSDGSPLVR
MELITALHGLILQYEREFQIAALRSSDSEPSLVPSNLSTSLTPGGWINVFIDSASSSSET
EKKSDHLSPMKRSPAAISNGSVNSESYSSGEDDESLPRPGPRTQSFAPPPPIARYHDNSS
SSGLYAQLWRGVQSICGDPCPTVALKAGSIIQSVLDKIRQTSKARDIAISSLSTSTSAPL
SVAPPPSSASVSHGKSHTIGRSSSKSRAVEPSSNSSLPAFLLTSRKDPQADDDNYPQLSP
GGSGSSSSIGSSASVYEETKFYDWSCKYFANSLMKQPEDCDRFSESYLQREFRFLRNHTV
REEGSQLIDSYDKAKFNDHIFVNKESKTPQELKFHPYIPQLVVLHKSSWSLWDIERGTHL
CTHSNHTGTSKATAVEFINPHDVSFLLTGTDDGCIRVWRNYLEEDEGSPKLVTSWRALSD
MQQSSRNVGMVMEWEQPTGLLYATGDVKYIRVWDTHKELKISDIPTGAESCVSSLALDHC
DKSLMVAGCGDGTIRLYDRRHPSSSSLVQVLKEHSSWILKVHIQQPVNNIVSMGAQGDVR
VWDPRFTRSTHNFNAMSGSNVCTIHHSVPLLACASNQAIKLYNIQNKESINSIRYHDGFM
GQKIGPTKSITFHPYKLWMAAGGSDGLISIYSSERKK
NT seq 3894 nt NT seq  +upstreamnt  +downstreamnt
atggaccattccactaaagacattctcccagtggatccagaggatgcatcagagcttgat
gactggcgccttccgctaagttatatgaagggacgtcacctggaggatattgctgggctc
cctccaatgaaagaaaactggaggataaaggaaagactcaagacgtggagtgtagcactt
gctctttgtttgaatattggagtcgacccgcccgacgtagtcaagacaacaccttgcgct
aggaaagagtgctggatagatccgttgtcaagaggatctcagaaggcgatggaattgatt
gctaatagtttacagaagcagtatgagagatggcaacccagagccaggtataagcagcta
ttagatccaaccactgatgaagtacggaaactttgcattgctctgaggaagaatgccaaa
aatgagagagttttgtttcattataacggacatggtgtgccacgcccaacagttaacgga
gagatatgggtctttaacaagtcatacacacagtacattccactgtcagtgtatgatttg
caagtgtggatgggcaaaccatcagtatatgtactggattgttcatatgcagctcaaatt
gttgattcttttaaattatttatacgagaaagggaaagcgaattctttttagagggatcc
attaatctctctacctcaaattcaagttgtctcggattattggacgagtccatattgcta
gctgcttgtggttccaaggagatactaccgatgaacccaaagcttcctgctgatctcttc
actgcctgtcttaccactcctataaagactgcactgttatggttttgcttgcaaagggtt
gggaagctagttcatggagtgacagaagaaatgattgacaacatacctggtaaactgaat
gaaaggaagactccactgggagagctcaattggatattcactgccatcactgacaccatt
gcatggaacacactatcacaagaattatttcagaagctgtttagacaggacctcctggtt
gctagcctgtataggaattacttgctggccgagaggataatgaggtcttataattgcacg
cccgagtcccacccgtacttacccccaacctaccagcacccgttgtggcaggcgtgggac
cttgcagtggatcatataatggctcagctacctcagctcattgacggaactcaagaatac
gaacccagctctttcttcccggagcagttaaatgctttccaagtttggttacttagtttt
cctaacttaagtcaacccccaacccagctgcctataatattacagtttctactcagtcag
gcccacagattacaagctcttgagttattaggaagatacctagatatgggccctgaagca
gtacatgcagctctctctgttggtatatttccgtatgtgttgaagctactggctagtaaa
ctccgtgagctacagcctatcctagtgttcatatgggctaagatactgtcagtagacaat
tgttgccagtctgatcttgttaaagatggcggttacaagtatttcatttcagtactagct
gatactactatacagtttgagtacaggacaatggctgccttcatactatcatctatatgt
aacaattacagtaaaggccaggaggtgtgtcttcaaggtaatgtggtcgcaatatgtctc
tctcagctagaggagcctaatgctgtcctcaagcagtggctagcgatatgtcttgggagg
ttatggcaaaaatatgacgcagccaaatggtgtggagtgagggacgctgcacatgaaaaa
ctctcactgcttctctgggatgaagtacccgaggttagggcagcagctgtgtttgctttg
ggtacttatatattcactccatcaactgacgggtcacacactgatcatgctactagtatt
gatcactctgtggcaatgcttctcctacctcttgtctctgatggatctcctcttgtcaga
atggagctcattacagcactgcatggtctcatcctacagtacgagagggagttccagata
gctgctctccgttcctctgattcagagccttcccttgtcccctctaacctctccacctcc
ctcactcctggtggctggatcaacgtcttcattgactccgcctcttcctcctccgagact
gaaaagaaaagtgaccatctttcccccatgaagaggagccctgctgccatcagcaatggc
agtgtcaacagtgagtcttatagcagtggcgaggacgacgagtctctcccacgtcccggc
ccacggacgcagtcttttgctccgccccctccgatagctcgttaccacgacaactcgtct
tcgagtggcctgtatgctcagttgtggcgaggggtccagtctatttgtggtgatccttgt
ccgactgttgctcttaaggctggctccatcattcaaagtgtcttggataaaataagacag
acttcaaaggctcgtgacattgccatttcctctctctccacttcaacctcagctcctctc
agcgtagcccctcccccttcctctgcttctgtttctcacggcaagtcgcacaccataggc
cgaagctccagcaagtctagagcagttgaaccgtcttccaattcatcgctaccggctttc
ttgctcacatcaagaaaagatcctcaagctgatgatgataattatcctcaattgtctcca
ggtggctctggaagcagtagctctattggctcatcggctagcgtctatgaagaaaccaag
ttctacgactggtcctgcaagtattttgcaaattcactaatgaagcaaccggaggactgt
gacaggtttagtgagagctacttgcagagggagtttcggttcttgcgtaatcacacagtg
agagaggaggggtcacagttgattgattcctatgataaagcaaagttcaacgatcacata
tttgttaacaaggagagcaagacaccccaagagctcaagtttcatccttacatacctcaa
ctggttgtacttcacaagtcatcatggagtctgtgggatatagaacgaggtactcacctc
tgcactcattccaatcacactggaaccagtaaggccactgctgtggagttcattaatcct
cacgacgtctcatttttactcacagggacagatgacgggtgcatcagagtctggaggaac
tacctagaagaggatgaaggaagtcctaaactagttaccagctggagggcattgagtgac
atgcagcaaagctctagaaatgttggtatggtaatggagtgggagcagcccacaggtctc
ctctatgctacaggtgatgtcaagtacatcagagtatgggacactcacaaggagctcaag
atcagtgacataccaacaggagccgagagctgtgtctccagccttgcactggaccactgt
gacaagtcactgatggtcgctgggtgtggggacggaaccattagactctatgacaggaga
cacccttcatcaagcagtttggttcaagtgttaaaggagcactccagttggatactcaaa
gtacatatccagcaacctgtcaataacattgtctctatgggtgctcagggagatgttcgt
gtctgggatccaaggttcactagatctacacacaatttcaatgcaatgtctggttctaat
gtatgcactatacatcattcagtacctctcctggcatgtgcgtccaatcaagccatcaag
ctgtataatattcaaaacaaagagtcgatcaactcgatacgttatcacgatggcttcatg
ggacagaaaataggaccaaccaaatctatcacctttcatccatataagttgtggatggcc
gctggtggatctgacggcttgatatcgatatattcaagcgagagaaagaaatga

DBGET integrated database retrieval system