KEGG   Amphimedon queenslandica (sponge): 100638672Help
Entry
100638672         CDS       T02284                                 

Definition
(RefSeq) CREB-binding protein-like isoform X3
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100638672
   04330 Notch signaling pathway
    100638672
   04350 TGF-beta signaling pathway
    100638672
   04068 FoxO signaling pathway
    100638672
Enzymes [BR:aqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100638672
Transcription factors [BR:aqu03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    100638672
Chromosome [BR:aqu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100638672
Mitochondrial biogenesis [BR:aqu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100638672
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 1966 aa AA seqDB search
MMDHQLLTDTNPVPASKKPRMNSDSEFGFIELPEELTDIQLLTGSDSNNLLDQPFPSAQQ
LDLPVPQSSNVATPPNMGTPTNNMTTPSNMVTPPINNINSNTGTPSPSNMGGIPSQLVTH
GSATPPPNAVVSTSGDPTPTLPSISSSPSHSFPPSSSLPQANATMTNSPYQMNMYQQRPH
PGMHPQGPMGGAPMHGNTYGMPRAAYHHAGMPRMMPGYNNPHMMSPHQPMLQSGGMGGMG
GMDHGYPSQPTHPQMMQQPIGGMYQHHAPPPPPPTHRIEVRSPQQQQQQMPQLPPVMSSG
QPSSASNDPEKRKLIQQQLVLLLHAHRCQQREREQQAHGGFRPCALPHCRTMKNVLNHMT
ECQAGRDCQFPHCASSRQIIYHWKNCNQQECPVCLPLKNTTRPNVGGSIGGVPNSMFGGD
VPPVSLPPHLVPTAPGAMAPGQNPPLPQKAGQPQGGGVGGVNPNPMGPAPGLPPSSTSGP
MGPNQSMPPNHVRAWHAEVNLDLRNHLIKKLVEAIYPVPNPNSMHDSRVKSLFQYAVKVE
NMMFENASSREDYYQKLAEKIYRVRKELDEKRRMNERRKAGAPNGFPDDGPHPITAVPQM
QGQPNSHSQGAPGSPFNEFSNPSLSFPLTPYSETTQKDVLKELISSIPGGTGTPGGLYTP
SPSDPSVPTVKSEIFSPPVSALPPSSSGPPPSSNNNFEDQTPQSALRAHLLSPTRTNLPP
SSAAPPVSMADMEGIEIKTETLISKPESQGPPPISAPPSALPNMRTPQTPQETSVASNRQ
ARRESITDSSYLPQATPTTFSPIPTPGPGDEKKAPVSKIKPDPSLVKIFTHDEIENALMP
VFNVVIRQEPESEPFKKPVNPIDLGIPDYFDIIKNPIDLSIIRRKLEDGSYSNPWQFCDD
IQLMFDNAWTYNKKTSRVYKFCSKLYEVFYENIDQAMVSLGYCCGQKHVFHPQVLYCYGK
LCPIPRDSPYYGYQNKYVYCTKCFTEIPGDSVAVSLDGTSNTSLPKGAFKEMKNDSVGIE
PMVECIHCKRSFHKICVLYHDAIWPEGYQCCNCLQRLRTTRKDNRFVAKRLPTTKLGSFL
EERVNSFLRNANVPGAEVTIRVVSSSNKLLDTRLGMMDRFSYFPSQFPYRTKALFVFEEI
DGAEVCFFGMHVQEYGSDCPAPNTRRVYISYLDSVHFFRPKEYRTLVYHEILIGYLEFCK
QNGFQTAHIWACPPGEGDDYIFHCHPMEQKIPKPKRLVEWYRNMLERGKDQSVLCDFQDI
FQYCVEEEITTVTDIPYFEGDFWPNVIEETIKELDQERKASEALSVDQQRGAGSKKAGKR
GTSKKGSKKATSRPKMGKKANPLVSGDDLTQKIYQTMDKHKEVFFVVYLQPPNQITSPLP
TTSDPDSLVTCELMDGRDAFLNLAREKHWEFSSLRRAKFSTMSMLYELHNQGDRFIYCCN
NCNTDVEFRWHCKECEDYDLCTTCYHKIGHEHPMERLGFNMGDEDPKSSSVSTTVSRVEM
QKRRIEFLIHACQCRDSSCSKQLCIKMKQLLRHAQNCKMRSSGKCSVCNFFVKLCAAHAQ
ECREIKCPVPLCANLKKKTRERRMREQARSFQLADRRIMAMNRSHPSPPTTTSEESANKP
NPSPAPPTPHPAQTPGKAVGSPNPHTPNPQAMVPVPSPAPPGPATPFTPAKDGSSPNVTV
QPPGAAMQSPQLMENNIQKLVQALCSPSPQDNLKAKEYLRTHTELVPRVIQGLQYLSRDK
EVSYLQQEFGNYVSRPPHPQQPVGGGAYMSPQVRPQVQMQPMQPMQRPMMPSSNTMMPNH
YHYPGGNPHMTHNRMPYQGQPMAAPGHSHLQHILQRPQYPSYGMQAPPPQYAAMKMQPRP
SMNMYQQNMMMQQQQPHPAMMQRMGPVPGAGPMMQPARFSMHQYRGPGGMDPGMGSMGSM
GGMGEPPQQQMLQYHHQYGANTNTNNNNTVMSQHFRTYYSKDQQSS
NT seq 5901 nt NT seq  +upstreamnt  +downstreamnt
atgatggatcaccagttattaactgatactaatcctgtcccagcaagcaagaaaccaaga
atgaacagcgattcagaatttggtttcattgagcttcccgaagagctaactgatatccag
ctcctaacaggttctgatagtaataaccttttggatcagcctttcccatcagctcagcaa
ttggatttaccagtaccacagtcctcgaacgtggcgacgcctccaaacatgggcacgccc
acaaataatatgaccacgccttcaaacatggtcacgcctccgatcaacaacatcaattca
aacactggtacaccctctccttcaaacatgggagggataccgtcccaactagttacccac
ggctctgctactcctcctcctaacgctgtagtcagcacttcaggagaccccactccaact
cttccctcaattagctcttctccttctcactccttccctccctcctcctctctaccccag
gccaacgccaccatgacaaactctccgtatcagatgaacatgtaccagcagcgtccccat
ccagggatgcacccccaaggtcccatgggaggtgcacctatgcatgggaacacttacggg
atgccgcgagcagcctaccatcacgctggaatgcctcgtatgatgcctgggtataataat
cctcatatgatgtcacctcaccagcccatgttacagtccggggggatgggaggtatgggc
ggaatggatcacgggtatcccagccagccgactcatcctcagatgatgcagcaacccatt
ggagggatgtaccagcatcatgccccaccccctcctccgcccacacacaggattgaagtg
agatcgccacaacagcagcaacaacaaatgcctcaacttccacctgtcatgagtagtgga
cagccctcctctgcaagcaatgacccagagaaaaggaaactcatccaacagcagctagta
ctcctccttcatgctcatcgctgtcagcagagggagagagagcagcaggcacacggtggg
ttcagaccctgtgctctgccacactgtaggacaatgaagaatgttcttaatcacatgaca
gagtgtcaagcagggagagactgtcaatttcctcattgtgcttcttcaagacagatcatt
tatcactggaagaactgcaaccagcaagaatgtcctgtatgccttcctcttaagaacacc
actcgtcccaatgtgggtggttccataggcggagtccctaattcaatgtttggtggtgac
gtccctccagtgagtctcccaccacacctggtcccaacagctcctggtgctatggctcct
ggtcagaatccacctttacctcaaaaagctggtcagcctcaaggaggaggagttggagga
gttaatcctaatccaatgggaccagctcctggtctccctccttcttctaccagtggaccc
atgggccctaatcaatccatgcctcctaaccatgttagagcatggcatgctgaagttaat
ttagacctaaggaatcaccttattaaaaaactagttgaagcaatatatccagttcctaat
ccaaacagtatgcatgatagtagagtgaagagtctattccaatatgctgtgaaagttgaa
aatatgatgtttgagaatgcaagcagtagggaggattattatcagaaactagcagaaaag
atttatcgtgttagaaaagaactggacgagaagagacgaatgaatgaaagaagaaaagca
ggtgctcctaatggcttccctgatgatggtcctcatccaatcactgctgtaccacagatg
caaggacagcctaacagccattcacaaggtgctccaggctctccttttaatgaattctca
aacccttctctctcatttcctctaactccatactctgagacgacccaaaaggacgtcctt
aaagagctcatctcctccatccctgggggcaccggaactccaggaggactctacacccca
tcaccatcggacccctcggtcccaaccgtcaagagcgaaatattctctccccccgtctct
gccctccctccctcctcctccggacctcccccgtcctctaataacaactttgaagaccag
accccacagtctgcactaagagctcatctcttgtctccaaccaggactaacttacctccg
tcctcggccgctcctcctgtgtccatggccgatatggaaggcattgagatcaagaccgag
actctcatttcaaagccggagtctcaaggcccgcctcccatctccgcccctccatcagct
cttcctaatatgaggactccacagactccccaggaaacatcagttgctagcaaccgtcag
gcgaggagagagagtatcactgatagttcgtacttgcctcaagccacacctaccaccttc
tcaccgatccctactccaggacctggcgatgagaagaaagcacctgttagtaagataaaa
ccagaccccagtttagtaaagatatttactcatgatgagattgagaatgcactgatgcca
gtgtttaatgtagtgataagacaagagcctgagtcggagccttttaagaaaccagtcaac
ccgattgaccttggaatacctgattattttgatattattaagaacccgattgatctctct
attattcggcggaagcttgaggacgggagctactcgaacccctggcagttctgtgatgat
attcagttaatgtttgataatgcttggacgtacaacaagaagacttcaagggtttataag
ttttgttcgaaactttacgaagtgttttacgagaatattgaccaggccatggtcagcctt
gggtattgctgtggacaaaagcatgtttttcatccacaagtcttgtattgttatgggaaa
ttgtgtcccattccaagagactctccttattacggctatcagaacaaatatgtgtactgt
actaagtgttttactgagattcctggtgatagtgtagcagtcagtttagatggtactagc
aatacttcactacccaaaggagctttcaaggaaatgaagaatgactctgttgggattgaa
ccgatggtagagtgtattcattgtaagaggtccttccataagatttgtgtattatatcat
gatgcaatttggcctgaaggctaccagtgctgcaactgcttgcagagactgaggaccacc
agaaaagataacagattcgttgcaaagagattacctactactaagctaggctcattttta
gaggagcgtgtcaactcgtttttaagaaacgctaatgtcccaggggctgaagttactatt
cgtgtcgtgtcttcgtcaaataaactactcgacactagactgggtatgatggataggttc
tcttatttcccctctcaattcccatatcgtacgaaagctctttttgtcttcgaagaaatt
gatggagcagaagtttgcttctttggtatgcacgtacaggagtatgggtctgactgtccc
gcccctaacactagacgtgtgtatatatcgtacttggatagtgttcacttcttcagaccc
aaggaataccgtaccctcgtctatcacgagattttgatcggataccttgagttttgcaaa
cagaacggtttccagacagctcatatatgggcctgtccgcctggagaaggtgatgactac
atttttcattgtcatcctatggagcagaagataccgaagccaaaaagactagtggagtgg
taccggaacatgctggagagagggaaggaccagtctgtcctctgtgactttcaagacata
ttccagtattgtgtggaagaggagatcactactgttaccgatataccttattttgagggt
gacttctggcctaatgttattgaagagactataaaggagttggatcaggagagaaaagca
tcagaagcattatctgttgatcaacagcgtggcgcaggctcgaagaaagctggtaaaaga
gggaccagtaagaaaggaagcaagaaagcaacgagcagaccaaagatgggaaagaaggct
aaccctttggtcagtggggacgacctcactcaaaagatctaccaaaccatggacaagcat
aaagaggtattttttgtagtatatcttcagcctcccaatcagatcacctctcctcttcct
acgacgtctgatcccgactctctcgtcacttgtgagctgatggacggacgcgacgctttc
cttaacctcgcccgagagaagcactgggagttctcgtcgctccgtagagcaaagttctcg
acaatgtcaatgctgtatgagttgcacaatcagggagacaggtttatttattgttgtaat
aattgtaacaccgacgtggagtttaggtggcattgtaaggaatgtgaggattacgatctc
tgcaccacctgttatcataagattggtcacgagcacccgatggagaggctcggtttcaat
atgggagatgaagaccccaaatcctcttctgtctcaactaccgtctctcgtgtggagatg
cagaagcgacgaatcgagttcctcatccatgcctgtcagtgcagggacagctcgtgctct
aagcagctctgtattaagatgaagcagttactgagacacgcccaaaactgtaagatgagg
tcatcagggaaatgctctgtctgtaatttctttgtcaagttgtgtgcggctcacgctcaa
gagtgtcgcgagatcaagtgtccagtcccgttatgtgctaatttgaaaaagaagacaaga
gagagacgaatgagagagcaggctagaagttttcaacttgccgaccgacgaataatggcc
atgaatcgctctcacccgtcccctcctaccactactagcgaggagagcgctaataaacca
aacccctcccctgccccgcctacacctcatcccgcccaaacacccggtaaagcagtgggg
tctcctaatccacacactccgaacccacaagcaatggtacctgttccgagccctgctcca
cctggtccagctactcccttcactccagccaaagacggctcttctcctaatgttaccgta
cagcccccaggagcagcaatgcagtctcctcagcttatggagaacaacattcagaagctg
gttcaggctctttgctctccgtcccctcaagataatttaaaagccaaagagtatctaaga
acccacactgagcttgtaccgcgagtgattcaaggactccagtatctctcacgtgacaag
gaggtctcttacttgcagcaagaatttgggaactatgtgtcgaggccgccacacccacag
cagcctgttgggggtggggcttacatgtcgcctcaggtccgtccgcaagtacaaatgcag
cctatgcaaccaatgcaaaggcccatgatgccttctagtaatacaatgatgcctaatcac
taccactatcctggaggcaacccacacatgactcacaaccgtatgccttaccagggacaa
ccaatggccgccccgggtcactctcaccttcagcacatactacaacgtcctcagtatcca
tcttacggcatgcaagcccctcctcctcagtatgcagccatgaaaatgcagccacgcccc
tcgatgaacatgtaccagcagaatatgatgatgcaacagcagcagccccacccagcgatg
atgcagcgaatgggtcctgttcctggagccgggccgatgatgcagcctgctaggtttagc
atgcatcagtatcgtggaccaggagggatggatccaggtatgggtagtatgggtagtatg
ggaggcatgggggaaccacctcagcagcagatgttgcagtatcatcatcagtacggagct
aatactaacactaataataataatacagtgatgagccaacattttagaacttattatagt
aaagatcagcagtcatcatag

DBGET integrated database retrieval system