KEGG   Amphimedon queenslandica (sponge): 100638672Help
Entry
100638672         CDS       T02284                                 

Definition
protein cbp-1-like
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:aqu04310]
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:aqu04330]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:aqu04350]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:aqu04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:aqu04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1965 aa AA seqDB search
MDHQLLTDTNPVPASKKPRMNSDSEFGFIELPEELTDIQLLTGSDSNNLLDQPFPSAQQL
DLPVPQSSNVATPPNMGTPTNNMTTPSNMVTPPINNINSNTGTPSPSNMGGIPSQLVTHG
SATPPPNAVVSTSGDPTPTLPSISSSPSHSFPPSSSLPQANATMTNSPYQMNMYQQRPHP
GMHPQGPMGGAPMHGNTYGMPRAAYHHAGMPRMMPGYNNPHMMSPHQPMLQSGGMGGMGG
MDHGYPSQPTHPQMMQQPIGGMYQHHAPPPPPPTHRIEVRSPQQQQQQMPQLPPVMSSGQ
PSSASNDPEKRKLIQQQLVLLLHAHRCQQREREQQAHGGFRPCALPHCRTMKNVLNHMTE
CQAGRDCQFPHCASSRQIIYHWKNCNQQECPVCLPLKNTTRPNVGGSIGGVPNSMFGGDV
PPVSLPPHLVPTAPGAMAPGQNPPLPQKAGQPQGGGVGGVNPNPMGPAPGLPPSSTSGPM
GPNQSMPPNHVRAWHAEVNLDLRNHLIKKLVEAIYPVPNPNSMHDSRVKSLFQYAVKVEN
MMFENASSREDYYQKLAEKIYRVRKELDEKRRMNERRKAGAPNGFPDDGPHPITAVPQMQ
GQPNSHSQGAPGSPFNEFSNPSLSFPLTPYSETTQKDVLKELISSIPGGTGTPGGLYTPS
PSDPSVPTVKSEIFSPPVSALPPSSSGPPPSSNNNFEDQTPQSALRAHLLSPTRTNLPPS
SAAPPVSMADMEGIEIKTETLISKPESQGPPPISAPPSALPNMRTPQTPQETSVASNRQA
RRESITDSSYLPQATPTTFSPIPTPGPGDEKKAPVSKIKPDPSLVKIFTHDEIENALMPV
FNVVIRQEPESEPFKKPVNPIDLGIPDYFDIIKNPIDLSIIRRKLEDGSYSNPWQFCDDI
QLMFDNAWTYNKKTSRVYKFCSKLYEVFYENIDQAMVSLGYCCGQKHVFHPQVLYCYGKL
CPIPRDSPYYGYQNKYVYCTKCFTEIPGDSVAVSLDGTSNTSLPKGAFKEMKNDSVGIEP
MVECIHCKRSFHKICVLYHDAIWPEGYQCCNCLQRLRTTRKDNRFVAKRLPTTKLGSFLE
ERVNSFLRNANVPGAEVTIRVVSSSNKLLDTRLGMMDRFSYFPSQFPYRTKALFVFEEID
GAEVCFFGMHVQEYGSDCPAPNTRRVYISYLDSVHFFRPKEYRTLVYHEILIGYLEFCKQ
NGFQTAHIWACPPGEGDDYIFHCHPMEQKIPKPKRLVEWYRNMLERGKDQSVLCDFQDIF
QYCVEEEITTVTDIPYFEGDFWPNVIEETIKELDQERKASEALSVDQQRGAGSKKAGKRG
TSKKGSKKATSRPKMGKKANPLVSGDDLTQKIYQTMDKHKEVFFVVYLQPPNQITSPLPT
TSDPDSLVTCELMDGRDAFLNLAREKHWEFSSLRRAKFSTMSMLYELHNQGDRFIYCCNN
CNTDVEFRWHCKECEDYDLCTTCYHKIGHEHPMERLGFNMGDEDPKSSSVSTTVSRVEMQ
KRRIEFLIHACQCRDSSCSKQLCIKMKQLLRHAQNCKMRSSGKCSVCNFFVKLCAAHAQE
CREIKCPVPLCANLKKKTRERRMREQARSFQLADRRIMAMNRSHPSPPTTTSEESANKPN
PSPAPPTPHPAQTPGKAVGSPNPHTPNPQAMVPVPSPAPPGPATPFTPAKDGSSPNVTVQ
PPGAAMQSPQLMENNIQKLVQALCSPSPQDNLKAKEYLRTHTELVPRVIQGLQYLSRDKE
VSYLQQEFGNYVSRPPHPQQPVGGGAYMSPQVRPQVQMQPMQPMQRPMMPSSNTMMPNHY
HYPGGNPHMTHNRMPYQGQPMAAPGHSHLQHILQRPQYPSYGMQAPPPQYAAMKMQPRPS
MNMYQQNMMMQQQQPHPAMMQRMGPVPGAGPMMQPARFSMHQYRGPGGMDPGMGSMGSMG
GMGEPPQQQMLQYHHQYGANTNTNNNNTVMSQHFRTYYSKDQQSS
NT seq 5898 nt NT seq  +upstreamnt  +downstreamnt
atggatcaccagttattaactgatactaatcctgtcccagcaagcaagaaaccaagaatg
aacagcgattcagaatttggtttcattgagcttcccgaagagctaactgatatccagctc
ctaacaggttctgatagtaataaccttttggatcagcctttcccatcagctcagcaattg
gatttaccagtaccacagtcctcgaacgtggcgacgcctccaaacatgggcacgcccaca
aataatatgaccacgccttcaaacatggtcacgcctccgatcaacaacatcaattcaaac
actggtacaccctctccttcaaacatgggagggataccgtcccaactagttacccacggc
tctgctactcctcctcctaacgctgtagtcagcacttcaggagaccccactccaactctt
ccctcaattagctcttctccttctcactccttccctccctcctcctctctaccccaggcc
aacgccaccatgacaaactctccgtatcagatgaacatgtaccagcagcgtccccatcca
gggatgcacccccaaggtcccatgggaggtgcacctatgcatgggaacacttacgggatg
ccgcgagcagcctaccatcacgctggaatgcctcgtatgatgcctgggtataataatcct
catatgatgtcacctcaccagcccatgttacagtccggggggatgggaggtatgggcgga
atggatcacgggtatcccagccagccgactcatcctcagatgatgcagcaacccattgga
gggatgtaccagcatcatgccccaccccctcctccgcccacacacaggattgaagtgaga
tcgccacaacagcagcaacaacaaatgcctcaacttccacctgtcatgagtagtggacag
ccctcctctgcaagcaatgacccagagaaaaggaaactcatccaacagcagctagtactc
ctccttcatgctcatcgctgtcagcagagggagagagagcagcaggcacacggtgggttc
agaccctgtgctctgccacactgtaggacaatgaagaatgttcttaatcacatgacagag
tgtcaagcagggagagactgtcaatttcctcattgtgcttcttcaagacagatcatttat
cactggaagaactgcaaccagcaagaatgtcctgtatgccttcctcttaagaacaccact
cgtcccaatgtgggtggttccataggcggagtccctaattcaatgtttggtggtgacgtc
cctccagtgagtctcccaccacacctggtcccaacagctcctggtgctatggctcctggt
cagaatccacctttacctcaaaaagctggtcagcctcaaggaggaggagttggaggagtt
aatcctaatccaatgggaccagctcctggtctccctccttcttctaccagtggacccatg
ggccctaatcaatccatgcctcctaaccatgttagagcatggcatgctgaagttaattta
gacctaaggaatcaccttattaaaaaactagttgaagcaatatatccagttcctaatcca
aacagtatgcatgatagtagagtgaagagtctattccaatatgctgtgaaagttgaaaat
atgatgtttgagaatgcaagcagtagggaggattattatcagaaactagcagaaaagatt
tatcgtgttagaaaagaactggacgagaagagacgaatgaatgaaagaagaaaagcaggt
gctcctaatggcttccctgatgatggtcctcatccaatcactgctgtaccacagatgcaa
ggacagcctaacagccattcacaaggtgctccaggctctccttttaatgaattctcaaac
ccttctctctcatttcctctaactccatactctgagacgacccaaaaggacgtccttaaa
gagctcatctcctccatccctgggggcaccggaactccaggaggactctacaccccatca
ccatcggacccctcggtcccaaccgtcaagagcgaaatattctctccccccgtctctgcc
ctccctccctcctcctccggacctcccccgtcctctaataacaactttgaagaccagacc
ccacagtctgcactaagagctcatctcttgtctccaaccaggactaacttacctccgtcc
tcggccgctcctcctgtgtccatggccgatatggaaggcattgagatcaagaccgagact
ctcatttcaaagccggagtctcaaggcccgcctcccatctccgcccctccatcagctctt
cctaatatgaggactccacagactccccaggaaacatcagttgctagcaaccgtcaggcg
aggagagagagtatcactgatagttcgtacttgcctcaagccacacctaccaccttctca
ccgatccctactccaggacctggcgatgagaagaaagcacctgttagtaagataaaacca
gaccccagtttagtaaagatatttactcatgatgagattgagaatgcactgatgccagtg
tttaatgtagtgataagacaagagcctgagtcggagccttttaagaaaccagtcaacccg
attgaccttggaatacctgattattttgatattattaagaacccgattgatctctctatt
attcggcggaagcttgaggacgggagctactcgaacccctggcagttctgtgatgatatt
cagttaatgtttgataatgcttggacgtacaacaagaagacttcaagggtttataagttt
tgttcgaaactttacgaagtgttttacgagaatattgaccaggccatggtcagccttggg
tattgctgtggacaaaagcatgtttttcatccacaagtcttgtattgttatgggaaattg
tgtcccattccaagagactctccttattacggctatcagaacaaatatgtgtactgtact
aagtgttttactgagattcctggtgatagtgtagcagtcagtttagatggtactagcaat
acttcactacccaaaggagctttcaaggaaatgaagaatgactctgttgggattgaaccg
atggtagagtgtattcattgtaagaggtccttccataagatttgtgtattatatcatgat
gcaatttggcctgaaggctaccagtgctgcaactgcttgcagagactgaggaccaccaga
aaagataacagattcgttgcaaagagattacctactactaagctaggctcatttttagag
gagcgtgtcaactcgtttttaagaaacgctaatgtcccaggggctgaagttactattcgt
gtcgtgtcttcgtcaaataaactactcgacactagactgggtatgatggataggttctct
tatttcccctctcaattcccatatcgtacgaaagctctttttgtcttcgaagaaattgat
ggagcagaagtttgcttctttggtatgcacgtacaggagtatgggtctgactgtcccgcc
cctaacactagacgtgtgtatatatcgtacttggatagtgttcacttcttcagacccaag
gaataccgtaccctcgtctatcacgagattttgatcggataccttgagttttgcaaacag
aacggtttccagacagctcatatatgggcctgtccgcctggagaaggtgatgactacatt
tttcattgtcatcctatggagcagaagataccgaagccaaaaagactagtggagtggtac
cggaacatgctggagagagggaaggaccagtctgtcctctgtgactttcaagacatattc
cagtattgtgtggaagaggagatcactactgttaccgatataccttattttgagggtgac
ttctggcctaatgttattgaagagactataaaggagttggatcaggagagaaaagcatca
gaagcattatctgttgatcaacagcgtggcgcaggctcgaagaaagctggtaaaagaggg
accagtaagaaaggaagcaagaaagcaacgagcagaccaaagatgggaaagaaggctaac
cctttggtcagtggggacgacctcactcaaaagatctaccaaaccatggacaagcataaa
gaggtattttttgtagtatatcttcagcctcccaatcagatcacctctcctcttcctacg
acgtctgatcccgactctctcgtcacttgtgagctgatggacggacgcgacgctttcctt
aacctcgcccgagagaagcactgggagttctcgtcgctccgtagagcaaagttctcgaca
atgtcaatgctgtatgagttgcacaatcagggagacaggtttatttattgttgtaataat
tgtaacaccgacgtggagtttaggtggcattgtaaggaatgtgaggattacgatctctgc
accacctgttatcataagattggtcacgagcacccgatggagaggctcggtttcaatatg
ggagatgaagaccccaaatcctcttctgtctcaactaccgtctctcgtgtggagatgcag
aagcgacgaatcgagttcctcatccatgcctgtcagtgcagggacagctcgtgctctaag
cagctctgtattaagatgaagcagttactgagacacgcccaaaactgtaagatgaggtca
tcagggaaatgctctgtctgtaatttctttgtcaagttgtgtgcggctcacgctcaagag
tgtcgcgagatcaagtgtccagtcccgttatgtgctaatttgaaaaagaagacaagagag
agacgaatgagagagcaggctagaagttttcaacttgccgaccgacgaataatggccatg
aatcgctctcacccgtcccctcctaccactactagcgaggagagcgctaataaaccaaac
ccctcccctgccccgcctacacctcatcccgcccaaacacccggtaaagcagtggggtct
cctaatccacacactccgaacccacaagcaatggtacctgttccgagccctgctccacct
ggtccagctactcccttcactccagccaaagacggctcttctcctaatgttaccgtacag
cccccaggagcagcaatgcagtctcctcagcttatggagaacaacattcagaagctggtt
caggctctttgctctccgtcccctcaagataatttaaaagccaaagagtatctaagaacc
cacactgagcttgtaccgcgagtgattcaaggactccagtatctctcacgtgacaaggag
gtctcttacttgcagcaagaatttgggaactatgtgtcgaggccgccacacccacagcag
cctgttgggggtggggcttacatgtcgcctcaggtccgtccgcaagtacaaatgcagcct
atgcaaccaatgcaaaggcccatgatgccttctagtaatacaatgatgcctaatcactac
cactatcctggaggcaacccacacatgactcacaaccgtatgccttaccagggacaacca
atggccgccccgggtcactctcaccttcagcacatactacaacgtcctcagtatccatct
tacggcatgcaagcccctcctcctcagtatgcagccatgaaaatgcagccacgcccctcg
atgaacatgtaccagcagaatatgatgatgcaacagcagcagccccacccagcgatgatg
cagcgaatgggtcctgttcctggagccgggccgatgatgcagcctgctaggtttagcatg
catcagtatcgtggaccaggagggatggatccaggtatgggtagtatgggtagtatggga
ggcatgggggaaccacctcagcagcagatgttgcagtatcatcatcagtacggagctaat
actaacactaataataataatacagtgatgagccaacattttagaacttattatagtaaa
gatcagcagtcatcatag

DBGET integrated database retrieval system